OX40 Ligand/TNFSF4 Protein, Rabbit (HEK293, His)

OX40 Ligand/TNFSF4 Protein, a cytokine, binds TNFRSF4, acting as a potent T-cell co-stimulator for proliferation and cytokine production. As a homotrimer, its pivotal interaction with TNFRSF4 enhances immune response by activating and expanding T-cells. This engagement contributes to intricate regulation, making OX40 Ligand a key mediator in modulating T-cell functions for effective and controlled immune activation. OX40 Ligand/TNFSF4 Protein, Rabbit (HEK293, His) is the recombinant rabbit-derived OX40 Ligand/TNFSF4 protein, expressed by HEK293, with N-His labeled tag.

The OX40 Ligand/TNFSF4 Protein, a cytokine, binds specifically to TNFRSF4, exerting its role as a potent co-stimulator for T-cell proliferation and cytokine production. Operating as a homotrimer, its interaction with TNFRSF4 plays a pivotal role in enhancing the immune response by promoting the activation and expansion of T-cells. Through this engagement, OX40 Ligand contributes to the intricate regulation of T-cell-mediated immune responses, serving as a key mediator in modulating T-cell functions for effective and controlled immune activation.

Rabbit

HEK293

N-His

O02765 (Q45-P187)

100008595

Extracellular Domain

QHSHAPEVSLQYPPIENIMTQLQILTSHECEEDSFILPLQKRDGTMEVQNNSVVIQCDGFYLLSLKGYFSQEVSISLHYRKGEEPFPILKKTKFANSNVVLKLGYKDKVYLNVTTDSASCKQLSVNAGELIVILQNPGGYCAP

Approximately 50-60 kDa, based on SDS-PAGE under non reducing (N) conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.