OX40 Ligand/TNFSF4 Protein, Rat (HEK293, His)

OX40 Ligand/TNFSF4 Protein, Rat (HEK293, His) is the recombinant rat-derived OX40 Ligand/TNFSF4 protein, expressed by HEK293, with C-His tag.

The OX40 Ligand/TNFSF4 Protein is a significant member of the tumor necrosis factor family, indicating its essential role in regulating immune responses and inflammatory processes. As part of this family, OX40 Ligand/TNFSF4 likely shares conserved structural and functional features with related proteins, emphasizing its involvement in signaling pathways associated with immune modulation. The classification within the tumor necrosis factor family underscores its specific designation within the broader context of cytokines, providing insights into its unique contributions to T cell activation and co-stimulation. The study of OX40 Ligand/TNFSF4 contributes to our understanding of its role in immune homeostasis, offering potential applications in immunotherapy and autoimmune disease management. Further exploration of OX40 Ligand/TNFSF4's role holds promise for enhancing our knowledge of its contributions to both normal immune function and pathological conditions.

Rat

HEK293

C-His

P15725 (V20-P210)

25572

Extracellular Domain

VTVKLNCVKDTYPSGHKCCRECQPGHGMVSRCDHTRDTVCHPCEPGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTEDTVCQCRPGTQPRQDSSHKLGVDCVPCPPGHFSPGSNQACKPWTNCTLSGKQIRHPASNSLDTVCEDRSLLATLLWETQRTTFRPTTVPSTTVWPRTSQLPSTPTLVAPEGP

Approximately 43-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.