1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Platelet CD Proteins Endothelial cell CD Proteins Cell Adhesion Molecules (CAMs)
  4. P-Selectin/CD62P Selectin
  5. P-Selectin
  6. P-Selectin Protein, Rhesus Macaque (HEK293, His)

P-Selectin Protein, Rhesus Macaque (HEK293, His)

Cat. No.: HY-P73687
COA Handling Instructions

P-Selectin Protein, Rhesus Macaque (HEK293, His) is a member of the selectin family of cell adhesion molecules. P-selectin (CD62P) has an N-terminal lectin domain, an epidermal growth factor motif, (generally) nine regulatory protein repeats, a transmembrane section and a short intracytoplasmic tail. P-selectin mediates leukocyte rolling on stimulated endothelial cells and heterotypic aggregation of activated platelets onto leukocytes. P-selectin mediates heterotypic aggregation of activated platelets to cancer cells and adhesion of cancer cells to stimulated endothelial cells. P-selectin glycoprotein ligand-1 (PSGL-1) is a major ligand for P-selectin. P-Selectin Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived P-Selectin protein, expressed by HEK293 , with C-His labeled tag. The total length of P-Selectin Protein, Rhesus Macaque (HEK293, His) is 730 a.a., with molecular weight of ~81.2 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $35 In-stock
10 μg $60 In-stock
50 μg $165 In-stock
100 μg $280 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

P-Selectin Protein, Rhesus Macaque (HEK293, His) is a member of the selectin family of cell adhesion molecules. P-selectin (CD62P) has an N-terminal lectin domain, an epidermal growth factor motif, (generally) nine regulatory protein repeats, a transmembrane section and a short intracytoplasmic tail. P-selectin mediates leukocyte rolling on stimulated endothelial cells and heterotypic aggregation of activated platelets onto leukocytes. P-selectin mediates heterotypic aggregation of activated platelets to cancer cells and adhesion of cancer cells to stimulated endothelial cells. P-selectin glycoprotein ligand-1 (PSGL-1) is a major ligand for P-selectin[1][2][3]. P-Selectin Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived P-Selectin protein, expressed by HEK293 , with C-His labeled tag. The total length of P-Selectin Protein, Rhesus Macaque (HEK293, His) is 730 a.a., with molecular weight of ~81.2 kDa.

Background

P-selectin is an adhesion molecule located in the platelet a granule and Weibel-Palade body of endothelial cells. P-selectin mediates the rolling of blood cells on the surface of the endothelium and initiates the attachment of leukocytes circulating in the blood to platelets, endothelial cells,and other leukocytes at sites of tissue injury and inflammation. P-selectin glycoprotein ligand-1 (PSGL-1) is a major ligand for P-selectin which is responsible for leukocyte rolling on active endothelium. Glycoprotein GPIb mediates platelet adhesion to subendothelium at sites of injury and the rolling of inactivated platelets on its activated surface. Sulfatides are ligands for P-selectin, which plays a role in platelet aggregation and adhesion[2].

Biological Activity

Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. P-Selectin, immobilized at 10 µg/mL, will induce 41.93% adhesion on U937 cells (100 µL/well at 1 x 105 cells/mL).

Species

Rhesus Macaque

Source

HEK293

Tag

C-His

Accession

XP_001094728 (W42-A771)

Gene ID

701277  [NCBI]

Molecular Construction
N-term
P-Selectin (W42-A771)
Accession # XP_001094728
His
C-term
Synonyms
P-selectin; GMP-140; LECAM3; PADGEM; CD62P; Selp
AA Sequence

WTYHYSTKAYSWNTSRKYCQNRYTDLVAIQNKKEIDYLNEVLPYYSTYYWIGIRKSNKTWTWVGTKKALTKEAENWADNEPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVTECGELELPQHVLMNCSHPLGNFSFNSQCSFHCADGYQVNGPSKLECLASGIWTHKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCGFSCEEGFVLVGPEVVQCTASGVWTAPAPVCKAVQCQHLEAPSEGTMDCIHPLAAFAYGSNCKFECQLGYRVRGLDTLRCIGSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFMLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEAQVNCSHPFGAFRYQSVCSFTCNEDLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCHFICDEGFSLSGPERLDCTRSGRWTDSPPTCEAIKCPELFAPEQGSLDCSDTHGEFNVGSTCHFSCNKGFKLEGPNNVKCTTSGRWSATPPACKGIASLPSPGVQCPALTTPGQGTMHCRHHPGTFGFNTTCYFGCNAGFTLTGDSILSCRPSGQWTAVTPTCRAVKCPELHVNKPIVMNCSNLWGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEA

Molecular Weight

Approximately 115 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
P-Selectin Protein, Rhesus Macaque (HEK293, His)
Cat. No.:
HY-P73687
Quantity:
MCE Japan Authorized Agent: