P-Selectin Protein, Rhesus Macaque (HEK293, His)
Based on 1 Customer Validation
P-Selectin Protein, Rhesus Macaque (HEK293, His) is a member of the selectin family of cell adhesion molecules. P-selectin (CD62P) has an N-terminal lectin domain, an epidermal growth factor motif, (generally) nine regulatory protein repeats, a transmembrane section and a short intracytoplasmic tail. P-selectin mediates leukocyte rolling on stimulated endothelial cells and heterotypic aggregation of activated platelets onto leukocytes. P-selectin mediates heterotypic aggregation of activated platelets to cancer cells and adhesion of cancer cells to stimulated endothelial cells. P-selectin glycoprotein ligand-1 (PSGL-1) is a major ligand for P-selectin. P-Selectin Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived P-Selectin protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rhesus Macaque
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
P-Selectin Protein, Rhesus Macaque (HEK293, His) is a member of the selectin family of cell adhesion molecules. P-selectin (CD62P) has an N-terminal lectin domain, an epidermal growth factor motif, (generally) nine regulatory protein repeats, a transmembrane section and a short intracytoplasmic tail. P-selectin mediates leukocyte rolling on stimulated endothelial cells and heterotypic aggregation of activated platelets onto leukocytes. P-selectin mediates heterotypic aggregation of activated platelets to cancer cells and adhesion of cancer cells to stimulated endothelial cells. P-selectin glycoprotein ligand-1 (PSGL-1) is a major ligand for P-selectin[1][2][3]. P-Selectin Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived P-Selectin protein, expressed by HEK293 , with C-His labeled tag.
Background
P-selectin is an adhesion molecule located in the platelet a granule and Weibel-Palade body of endothelial cells. P-selectin mediates the rolling of blood cells on the surface of the endothelium and initiates the attachment of leukocytes circulating in the blood to platelets, endothelial cells,and other leukocytes at sites of tissue injury and inflammation. P-selectin glycoprotein ligand-1 (PSGL-1) is a major ligand for P-selectin which is responsible for leukocyte rolling on active endothelium. Glycoprotein GPIb mediates platelet adhesion to subendothelium at sites of injury and the rolling of inactivated platelets on its activated surface. Sulfatides are ligands for P-selectin, which plays a role in platelet aggregation and adhesion[2].
Verified Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. P-Selectin, immobilized at 10 µg/mL, will induce 41.93% adhesion on U937 cells (100 µL/well at 1 x 105 cells/mL).
Technical Parameters
-
Species Rhesus Macaque
-
Source HEK293
-
Tag C-His
-
Accession
XP_001094728.1 (W42-A771)
-
Molecular Construction
-
N-term
-
P-Selectin (W42-A771)
Accession # XP_001094728.1 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
SELP; Selectin P (Granule Membrane Protein 140kDa, Antigen CD62); Prev. GRMP; LECAM3; P-Selectin; Selectin P (Granule Membrane Protein 140kD, Antigen CD62); PADGEM; Leukocyte-Endothelial Cell Adhesion Molecule 2; Platelet Activation Dependent Granule-Exte
-
AA Sequence
WTYHYSTKAYSWNTSRKYCQNRYTDLVAIQNKKEIDYLNEVLPYYSTYYWIGIRKSNKTWTWVGTKKALTKEAENWADNEPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVTECGELELPQHVLMNCSHPLGNFSFNSQCSFHCADGYQVNGPSKLECLASGIWTHKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCGFSCEEGFVLVGPEVVQCTASGVWTAPAPVCKAVQCQHLEAPSEGTMDCIHPLAAFAYGSNCKFECQLGYRVRGLDTLRCIGSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFMLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEAQVNCSHPFGAFRYQSVCSFTCNEDLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCHFICDEGFSLSGPERLDCTRSGRWTDSPPTCEAIKCPELFAPEQGSLDCSDTHGEFNVGSTCHFSCNKGFKLEGPNNVKCTTSGRWSATPPACKGIASLPSPGVQCPALTTPGQGTMHCRHHPGTFGFNTTCYFGCNAGFTLTGDSILSCRPSGQWTAVTPTCRAVKCPELHVNKPIVMNCSNLWGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEA
-
Molecular Weight
Approximately 115 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (240 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
