PD-1 Protein, Mouse (HEK293, His-Fc)

Determined by its ability to prevent plate adhesion of PHA-stimulated Jurkat cells in the presence of 625 ng/mL of bound hPD-L1. The ED₅₀ for this effect is 0.4262 μg/mL, corresponding to a specific activity is 2.35×10³ units/mg.

• 
  Determined by its ability to prevent plate adhesion of PHA-stimulated Jurkat cells in the presence of 625ng/mL of bound hPD-L1. The ED₅₀ for this effect is 0.4262 μg/mL, corresponding to a specific activity is 2.35×10³ units/mg.

Mouse

HEK293

C-hFc;C-8*His

NP_032824.1 (L25-Q167)

18566  [NCBI]

LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ

60-65 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 (Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.) or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.