PD-L1 Protein, Cynomolgus/Rhesus Macaque (HEK293, His)

The PD-L1 protein critically regulates immune tolerance by acting as a ligand for PDCD1/PD-1, regulating T cell activation threshold, and limiting effector responses. It may act as a costimulatory molecule for IL10-producing T cell subsets. PD-L1 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived PD-L1 protein, expressed by HEK293 , with C-His labeled tag.

PD-L1 Protein assumes a critical role in both the induction and maintenance of immune tolerance to self, acting as a ligand for the inhibitory receptor PDCD1/PD-1 and thereby modulating the activation threshold of T-cells, ultimately limiting their effector response. Additionally, PD-L1 may function as a costimulatory molecule for T-cell subsets that predominantly produce interleukin-10 (IL10) through an as yet unidentified activating receptor. Beyond its role as an immune checkpoint, PD-L1 also acts as a transcription coactivator, translocating into the nucleus in response to hypoxia and interacting with phosphorylated STAT3 to promote the transcription of GSDMC, leading to pyroptosis. Exploited by tumors to attenuate anti-tumor immunity and escape immune system destruction, the PDCD1-mediated inhibitory pathway facilitated by PD-L1 interaction with PDCD1/PD-1 inhibits cytotoxic T lymphocytes (CTLs) effector function. Blocking the PDCD1-mediated pathway has shown promise in reversing exhausted T-cell phenotypes and normalizing anti-tumor responses, providing a rationale for cancer immunotherapy.

Immobilized Anti-PDL1 Antibody at 2 μg/ml (100 μl/well) can bind Cynomolgus / Rhesus PD-L1 / B7-H1 / CD274 Protein (His Tag) , the EC₅₀ is 1-2 ng/mL.

Rhesus Macaque

HEK293

C-His

A0A096P1K9/XP_015292694 (F19-T239)

102145573  [NCBI]

Extracellular Domain

FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLTSLIVYWEMEDKNIIQFVHGEEDLKVQHSNYRQRAQLLKDQLSLGNAALRITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLLNVTSTLRINTTANEIFYCIFRRLDPEENHTAELVIPELPLALPPNERT

Approximately 26.7 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.