1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. PDGFs & PDGFRs
  4. PDGF
  5. PDGF-AA
  6. PDGF-AA Protein, Human (His)

PDGF-AA Protein, Human (His) is a member of PDGF family, binds to FDGFR, and may has the potential to enhance wound healing.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
Muestra gratis (2 μg)   Apply now
2 μg En stock
10 μg En stock
50 μg En stock
100 μg En stock
500 μg En stock
> 500 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

  • Referencias

Descripciòn

PDGF-AA Protein, Human (His) is a member of PDGF family, binds to FDGFR, and may has the potential to enhance wound healing.

Background

Platelet-Derived Growth Factor-AA is a member of PDGF family, which promotes cell proliferation, survival and migration, through binding to the tyrosine kinase PDGF receptor[1]. PDGF-AA may play a crucial role in the ability of ASCs and EPCs to enhance wound healing, especially in animal models with wound-healing deficits[2].

Actividad biológica

Measured in a cell proliferation assay using NIH-3T3 mouse fibroblast cells. The ED50 for this effect is 53.43 ng/mL, corresponding to a specific activity is 1.87×104 units/mg.

  • Measured in a cell proliferation assay using NIH-3T3 mouse fibroblast cells. The ED50 for this effect is 53.43 ng/mL, corresponding to a specific activity is 1.87×104 units/mg.
Species

Human

Source

E. coli

Tag

N-6*His

Accession

P04085-1 (S87-T211)

Gene ID
Molecular Construction
N-term
6*His
PDGF-AA (S87-T211)
Accession # P04085-1
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
PDGFAA; PDGF-AA
AA Sequence

SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT

Predicted Molecular Mass
15.9 kDa
Peso molecular

Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.

Pureza
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 4 mM HCl.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación
Referencias

PDGF-AA Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

PDGF-AA Protein, Human (His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
PDGF-AA Protein, Human (His)
Cat. No.:
HY-P70825
Cantidad:
MCE Japan Authorized Agent: