1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Receptor Proteins Fluorescent-labeled Recombinant Proteins
  3. Interleukin & Receptors NK Cell CD Proteins Cytokine Receptors
  4. IL-15 Receptor IL-15R alpha/CD215
  5. PE-Labeled IL-15R alpha Protein, Human (HEK293, Fc)

PE-Labeled IL-15R alpha Protein, Human (HEK293, Fc)

Cat. No.: HY-P701299
Handling Instructions Technical Support

IL-15R alpha Protein, a proven high-affinity receptor for interleukin-15, signals in both cis and trans. In neutrophils, it activates SYK kinase, crucial for IL-15-induced phagocytosis in a SYK-dependent manner. Different isoforms may introduce variations in signal transduction. Notably, IL-15R alpha Protein, while having high affinity, does not directly bind to IL15. PE-Labeled IL-15R alpha Protein, Human (HEK293, Fc) is the recombinant human-derived PE-Labeled IL-15R alpha protein, expressed by HEK293 , with Fc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-15R alpha Protein, a proven high-affinity receptor for interleukin-15, signals in both cis and trans. In neutrophils, it activates SYK kinase, crucial for IL-15-induced phagocytosis in a SYK-dependent manner. Different isoforms may introduce variations in signal transduction. Notably, IL-15R alpha Protein, while having high affinity, does not directly bind to IL15. PE-Labeled IL-15R alpha Protein, Human (HEK293, Fc) is the recombinant human-derived PE-Labeled IL-15R alpha protein, expressed by HEK293 , with Fc labeled tag.

Background

IL-15R alpha Protein stands out as a high-affinity receptor for interleukin-15, as evidenced by studies. This receptor exhibits the remarkable capability to signal both in cis and trans, where IL15R from one subset of cells presents interleukin-15 to neighboring IL2RG-expressing cells (By similarity). Notably, in neutrophils, IL-15R alpha Protein binds to and activates the kinase SYK in response to interleukin-15 stimulation, playing a critical role in IL-15-induced phagocytosis in a SYK-dependent manner. It's important to note that the expression of different isoforms may introduce variations or interference with signal transduction processes. Despite its high affinity for interleukin-15, it is specified that IL-15R alpha Protein does not directly bind to IL15.

Species

Human

Source

HEK293

Tag

Fc

Accession

Q13261-1 (I31-T205)

Gene ID

3601

Protein Length

Extracellular Domain

Synonyms
IL-15 R alpha; CD215; IL15RA; IL-15RA; IL-15R-alpha
AA Sequence

ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT

Predicted Molecular Mass
46.6 kDa
Glycosylation
Yes
Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PE-Labeled IL-15R alpha Protein, Human (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PE-Labeled IL-15R alpha Protein, Human (HEK293, Fc)
Cat. No.:
HY-P701299
Quantity:
MCE Japan Authorized Agent: