1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. PHPT1 Protein, Human (P.pastoris, His)

PHPT1 Protein, Human (P.pastoris, His)

Cat. No.: HY-P71769
Handling Instructions

The PHPT1 protein acts as a phosphohistidine phosphatase, catalyzing the dephosphorylation of phosphohistidine residues. This unique enzymatic activity makes PHPT1 a regulator of histidine phosphorylation events, suggesting that it is involved in signaling pathways or cellular processes that are critical for phosphohistidine modification. PHPT1 Protein, Human (P.pastoris, His) is the recombinant human-derived PHPT1 protein, expressed by P. pastoris , with N-His labeled tag. The total length of PHPT1 Protein, Human (P.pastoris, His) is 125 a.a., with molecular weight of ~15.8 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PHPT1 protein acts as a phosphohistidine phosphatase, catalyzing the dephosphorylation of phosphohistidine residues. This unique enzymatic activity makes PHPT1 a regulator of histidine phosphorylation events, suggesting that it is involved in signaling pathways or cellular processes that are critical for phosphohistidine modification. PHPT1 Protein, Human (P.pastoris, His) is the recombinant human-derived PHPT1 protein, expressed by P. pastoris , with N-His labeled tag. The total length of PHPT1 Protein, Human (P.pastoris, His) is 125 a.a., with molecular weight of ~15.8 kDa.

Background

PHPT1 protein serves as a phosphohistidine phosphatase, showcasing its specific enzymatic activity in catalyzing the dephosphorylation of phosphohistidine residues. This unique biochemical function positions PHPT1 as a regulator of histidine phosphorylation events, suggesting its involvement in signaling pathways or cellular processes where phosphohistidine modification plays a crucial role. The enzymatic capability of PHPT1 underscores its potential significance in modulating histidine phosphorylation dynamics and highlights its contribution to cellular regulatory mechanisms.

Species

Human

Source

P. pastoris

Tag

N-His

Accession

Q9NRX4 (1M-125Y)

Gene ID
Molecular Construction
N-term
His
PHPT1 (1M-125Y)
Accession # Q9NRX4
C-term
Synonyms
14kDa phosphohistidine phosphatase; CGI 202; HSPC141; Phosphohistidine phosphatase 1; PHP14
AA Sequence

MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY

Molecular Weight

Approximately 15.8 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PHPT1 Protein, Human (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PHPT1 Protein, Human (P.pastoris, His)
Cat. No.:
HY-P71769
Quantity:
MCE Japan Authorized Agent: