PHPT1 Protein, Human (P.pastoris, His)

The PHPT1 protein acts as a phosphohistidine phosphatase, catalyzing the dephosphorylation of phosphohistidine residues. This unique enzymatic activity makes PHPT1 a regulator of histidine phosphorylation events, suggesting that it is involved in signaling pathways or cellular processes that are critical for phosphohistidine modification. PHPT1 Protein, Human (P.pastoris, His) is the recombinant human-derived PHPT1 protein, expressed by P. pastoris , with N-His labeled tag.

PHPT1 protein serves as a phosphohistidine phosphatase, showcasing its specific enzymatic activity in catalyzing the dephosphorylation of phosphohistidine residues. This unique biochemical function positions PHPT1 as a regulator of histidine phosphorylation events, suggesting its involvement in signaling pathways or cellular processes where phosphohistidine modification plays a crucial role. The enzymatic capability of PHPT1 underscores its potential significance in modulating histidine phosphorylation dynamics and highlights its contribution to cellular regulatory mechanisms.

Human

P. pastoris

N-His

Q9NRX4-1 (M1-Y125)

29085  [NCBI]

Full Length of Isoform-1

MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.