PHPT1 Protein, Human (P.pastoris, His)
The PHPT1 protein acts as a phosphohistidine phosphatase, catalyzing the dephosphorylation of phosphohistidine residues. This unique enzymatic activity makes PHPT1 a regulator of histidine phosphorylation events, suggesting that it is involved in signaling pathways or cellular processes that are critical for phosphohistidine modification. PHPT1 Protein, Human (P.pastoris, His) is the recombinant human-derived PHPT1 protein, expressed by P. pastoris , with N-His labeled tag.
- Species: Human
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The PHPT1 protein acts as a phosphohistidine phosphatase, catalyzing the dephosphorylation of phosphohistidine residues. This unique enzymatic activity makes PHPT1 a regulator of histidine phosphorylation events, suggesting that it is involved in signaling pathways or cellular processes that are critical for phosphohistidine modification. PHPT1 Protein, Human (P.pastoris, His) is the recombinant human-derived PHPT1 protein, expressed by P. pastoris , with N-His labeled tag.
Background
PHPT1 protein serves as a phosphohistidine phosphatase, showcasing its specific enzymatic activity in catalyzing the dephosphorylation of phosphohistidine residues. This unique biochemical function positions PHPT1 as a regulator of histidine phosphorylation events, suggesting its involvement in signaling pathways or cellular processes where phosphohistidine modification plays a crucial role. The enzymatic capability of PHPT1 underscores its potential significance in modulating histidine phosphorylation dynamics and highlights its contribution to cellular regulatory mechanisms.
Technical Parameters
-
Species Human
-
Source P. pastoris
-
Tag N-His
-
Accession
Q9NRX4-1 (M1-Y125)
-
Molecular Construction
-
N-term
-
His
-
PHPT1 (M1-Y125)
Accession # Q9NRX4-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
PHPT1; Protein Janus-A Homolog; Phosphohistidine Phosphatase 1; DKFZp564M173; PHP14; BA216L13.10; 14 KDa Phosphohistidine Phosphatase; PHP; Protein Histidine Phosphatase; Epididymis Secretory Sperm Binding Protein Li 132P; HSPC141; Phosphohistidine Phosph
-
AA Sequence
MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
-
Predicted Molecular Mass
15.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
