PLA2G1B Protein, Human (HEK293, His)
Based on 1 publication(s) in Google Scholar
The PLA2G1B protein is a secreted calcium-dependent phospholipase A2 that targets dietary phospholipids in the intestine. It hydrolyzes the fatty acyl group at the sn-2 position, preferentially hydrolyzing phosphatidylethanolamine and phosphatidylglycerol. PLA2G1B Protein, Human (HEK293, His) is the recombinant human-derived PLA2G1B protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The PLA2G1B protein is a secreted calcium-dependent phospholipase A2 that targets dietary phospholipids in the intestine. It hydrolyzes the fatty acyl group at the sn-2 position, preferentially hydrolyzing phosphatidylethanolamine and phosphatidylglycerol. PLA2G1B Protein, Human (HEK293, His) is the recombinant human-derived PLA2G1B protein, expressed by HEK293 , with C-6*His labeled tag.
Background
The PLA2G1B protein is a secretory calcium-dependent phospholipase A2 that primarily targets dietary phospholipids in the intestinal tract. It hydrolyzes the ester bond of the fatty acyl group attached at the sn-2 position of phospholipids, with a preference for phosphatidylethanolamines and phosphatidylglycerols over phosphatidylcholines. This protein may play a role in the biosynthesis of N-acyl ethanolamines, which regulate energy metabolism and inflammation in the intestinal tract. It also hydrolyzes N-acyl phosphatidylethanolamines to N-acyl lysophosphatidylethanolamines, which are further cleaved by a lysophospholipase D to release N-acyl ethanolamines. It may act in an autocrine and paracrine manner and, when bound to the PLA2R1 receptor, can regulate podocyte survival and glomerular homeostasis. Additionally, PLA2G1B has anti-helminth activity, which is regulated by the gut microbiota. Upon helminth infection of intestinal epithelia, it directly affects phosphatidylethanolamine contents in the membrane of helminth larvae, potentially controlling processes such as membrane fusion and cell division while aiding in immune recognition. This ultimately reduces larvae integrity and infectivity.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Ren Fail
HBx-induced PLA2R overexpression mediates podocyte pyroptosis through the ROS-NLRP3 signaling pathway. [Abstract]2023 Dec;45(1):2170808. PMID: 36698326
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P04054 (A23-S148)
-
Molecular Construction
-
N-term
-
PLA2G1B (A23-S148)
Accession # P04054 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PLA2G1B; Phospholipase A2; Prev. PLA2A; Phospholipase A2, Group IB (Pancreas); Prev. PPLA2; Group IB Phospholipase A2; Prev. PLA2; Phospholipase A2 Group IB; Phosphatidylcholine 2-Acylhydrolase 1B
-
AA Sequence
AVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS
-
Predicted Molecular Mass
15.2 kDa
-
Molecular Weight
Approximately 17-20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 10% glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)