1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. PLA2G1B Protein, Mouse (HEK293, His)

The PLA2G1B protein is a secreted calcium-dependent phospholipase A2 that targets dietary phospholipids in the intestine.Phosphatidylethanolamine and phosphatidylglycerol are preferred, which hydrolyze the ester bond of the fatty acyl group at the sn-2 position.PLA2G1B Protein, Mouse (HEK293, His) is the recombinant mouse-derived PLA2G1B protein, expressed by HEK293 , with C-6*His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
10 μg En stock
50 μg En stock
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

The PLA2G1B protein is a secreted calcium-dependent phospholipase A2 that targets dietary phospholipids in the intestine.Phosphatidylethanolamine and phosphatidylglycerol are preferred, which hydrolyze the ester bond of the fatty acyl group at the sn-2 position.PLA2G1B Protein, Mouse (HEK293, His) is the recombinant mouse-derived PLA2G1B protein, expressed by HEK293 , with C-6*His labeled tag.

Background

PLA2G1B is a secretory calcium-dependent phospholipase A2 that predominantly targets dietary phospholipids in the intestinal tract. Exhibiting phospholipase A2 activity, it hydrolyzes the ester bond of the fatty acyl group at the sn-2 position of phospholipids, with a preference for phosphatidylethanolamines and phosphatidylglycerols over phosphatidylcholines. PLA2G1B may play a crucial role in the biosynthesis of N-acyl ethanolamines, regulating energy metabolism and inflammation in the intestinal tract. It acts in an autocrine and paracrine manner and, upon binding to the PLA2R1 receptor, can regulate podocyte survival and glomerular homeostasis. Additionally, PLA2G1B exhibits anti-helminth activity, impacting the integrity and infectivity of helminth larvae by directly affecting phosphatidylethanolamine contents in their membranes during intestinal epithelia infection, a process regulated by gut microbiota.

Actividad biológica

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Assay Procedure

Materials
Assay buffer: 50 mM HEPES, 1 mg/mL BSA, pH 7.0
Substrate buffer: 50 mM HEPES, 20 mM CaCl?, 1 mg/mL BSA, pH 7.0
PLA2G1B Protein, Mouse (HEK293, His) (HY-P71212)
Trypsin
Substrate: 1-hexadecanoyl-2-(1-pyrenedecanoyl)-sn-glycero-3-phosphocholine (16:0-Pyr PC). Dilute to 2 mM in DMSO first, then dilute to a final stock concentration of 400 μM in ethanol
Standard: 1-Pyrenedecanoic Acid

Procedure
1. Preparation of standard curve: Dilute the standard with assay buffer to concentrations of 0, 0.1, 1, 2.5, 5, 10, 25, 50, and 100 μM. Add 100 μL of each dilution to a 96-well black microplate, and read the fluorescence intensity in endpoint mode with excitation and emission wavelengths of 345 nm and 395 nm (top read).
2. Thaw the frozen substrate at 37°C for 5 minutes and mix well.
3. Dilute Mouse PLA2G1B protein to 100 μg/mL in assay buffer.
4. Dilute trypsin to 0.5 μg/mL in assay buffer.
5. Mixture preparation: Mix equal volumes of diluted trypsin and Mouse PLA2G1B protein, and incubate at room temperature for 30 minutes.
6. Dilute the substrate to 100 μM in substrate buffer.
Experimental group: 50 μL mixture + 50 μL substrate.
Blank group: 50 μL assay buffer + 50 μL substrate.
7. Read in kinetic mode for 5 minutes with excitation and emission wavelengths of 345 nm and 395 nm (top read) respectively.
8. Calculate the specific activity:

     Specific Activity (pmol/min/μg) =

Adjusted Vmax* (RFU/min) x Conversion Factor ** (pmol/RFU)
amount of enzyme (μg)

*Adjusted for Substrate Blank
**Derived using calibration standard

Per Well:
Mouse PLA2G1B: 5 μg
Substrate: 50 μM

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q9Z0Y2 (A16-C146)

Gene ID
Molecular Construction
N-term
PLA2G1B (A16-C146)
Accession # Q9Z0Y2
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Phospholipase A2; Group IB phospholipase A2; PLA2-Ib; Phosphatidylcholine 2-acylhydrolase 1B; Pla2g1b; Pla2
AA Sequence

AHSISPRAVWQFRNMIKCTIPGSDPLKDYNNYGCYCGLGGWGTPVDDLDRCCQTHDHCYSQAKKLESCKFLIDNPYTNTYSYSCSGSEITCSAKNNKCEDFICNCDREAAICFSKVPYNKEYKNLDTGKFC

Peso molecular

Approximately 15.0 kDa

Pureza
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM HEPES, 150 mM NaCl, pH 7.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Envío

Shipping with dry ice.

Documentación

PLA2G1B Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

PLA2G1B Protein, Mouse (HEK293, His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
PLA2G1B Protein, Mouse (HEK293, His)
Cat. No.:
HY-P71212
Cantidad:
MCE Japan Authorized Agent: