PLA2G1B Protein, Mouse (HEK293, His)

The PLA2G1B protein is a secreted calcium-dependent phospholipase A2 that targets dietary phospholipids in the intestine. Phosphatidylethanolamine and phosphatidylglycerol are preferred, which hydrolyze the ester bond of the fatty acyl group at the sn-2 position. PLA2G1B Protein, Mouse (HEK293, His) is the recombinant mouse-derived PLA2G1B protein, expressed by HEK293 , with C-6*His labeled tag. The total length of PLA2G1B Protein, Mouse (HEK293, His) is 131 a.a., with molecular weight of ~15.0 kDa.

PLA2G1B is a secretory calcium-dependent phospholipase A2 that predominantly targets dietary phospholipids in the intestinal tract. Exhibiting phospholipase A2 activity, it hydrolyzes the ester bond of the fatty acyl group at the sn-2 position of phospholipids, with a preference for phosphatidylethanolamines and phosphatidylglycerols over phosphatidylcholines. PLA2G1B may play a crucial role in the biosynthesis of N-acyl ethanolamines, regulating energy metabolism and inflammation in the intestinal tract. It acts in an autocrine and paracrine manner and, upon binding to the PLA2R1 receptor, can regulate podocyte survival and glomerular homeostasis. Additionally, PLA2G1B exhibits anti-helminth activity, impacting the integrity and infectivity of helminth larvae by directly affecting phosphatidylethanolamine contents in their membranes during intestinal epithelia infection, a process regulated by gut microbiota.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Mouse

HEK293

C-6*His

Q9Z0Y2 (A16-C146)

18778  [NCBI]

AHSISPRAVWQFRNMIKCTIPGSDPLKDYNNYGCYCGLGGWGTPVDDLDRCCQTHDHCYSQAKKLESCKFLIDNPYTNTYSYSCSGSEITCSAKNNKCEDFICNCDREAAICFSKVPYNKEYKNLDTGKFC

Approximately 15.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM HEPES, 150 mM NaCl, pH 7.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.