1. Recombinant Proteins
  2. Others
  3. Podoplanin Protein, Human (HEK293, His-Fc)

The Podoplanin protein is a multifaceted regulator that affects cell migration and adhesion through multiple interactions. In hemo-lymphatic dissociation, Podoplanin binds to CLEC1B, triggering platelet activation that is counteracted by the CD9 interaction. Podoplanin Protein, Human (HEK293, His-Fc) is the recombinant human-derived Podoplanin protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Podoplanin protein is a multifaceted regulator that affects cell migration and adhesion through multiple interactions. In hemo-lymphatic dissociation, Podoplanin binds to CLEC1B, triggering platelet activation that is counteracted by the CD9 interaction. Podoplanin Protein, Human (HEK293, His-Fc) is the recombinant human-derived Podoplanin protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Background

Podoplanin Protein emerges as a multifaceted regulator, exerting diverse effects on cell migration and adhesion through interactions with various partners. During development, Podoplanin plays a crucial role in the separation of blood and lymphatic vessels by binding to CLEC1B, triggering platelet activation and aggregation. Conversely, its interaction with CD9 attenuates platelet aggregation induced by Podoplanin. The protein, through interactions with MSN or EZR, promotes epithelial-mesenchymal transition (EMT), leading to increased cell migration and invasiveness. Binding with CD44 facilitates directional cell migration in epithelial and tumor cells. In lymph nodes, Podoplanin controls fibroblastic reticular cells (FRCs) adhesion to the extracellular matrix (ECM) and actomyosin contraction by maintaining ERM proteins (EZR, MSN, and RDX) and MYL9 activation. Engagement with CLEC1B promotes FRC relaxation by blocking lateral membrane interactions. Podoplanin also participates in connecting the lymphatic endothelium to the surrounding ECM through its interaction with LGALS8. In keratinocytes, Podoplanin induces morphological changes, increased motility, and decreased cell adhesion. Furthermore, Podoplanin regulates invadopodia stability and maturation in tumor cells, contributing to efficient ECM degradation. The protein is homodimeric and interacts with a range of partners, including CLEC1B, CD9, LGALS8, CD44, MSN, EZR, and CCL21, showcasing its intricate involvement in various cellular processes and signaling pathways. Further research is crucial to unravel the precise molecular mechanisms and broader implications of Podoplanin in these diverse cellular functions.

Biological Activity

Measured by its binding ability in a functional ELISA.Immobilized human Podoplanin at 10 μg/mL (100 μl/well) can bind biotinylated human CLEC1B-His, The EC50 of biotinylated human CLEC1B-His is 0.4-1.0 μg/mL.

Species

Human

Source

HEK293

Tag

C-hFc;C-His

Accession

Q86YL7-1 (A23-K123)

Gene ID
Molecular Construction
N-term
Podoplanin (A23-K123)
Accession # Q86YL7-1
hFc-His
C-term
Protein Length

Partial

Synonyms
Podoplanin; Aggrus; Glycoprotein 36; Gp36; T1-Alpha; T1A; PDPN; GP36
AA Sequence

ASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEK

Predicted Molecular Mass
50.2 kDa
Molecular Weight

Approximately 53-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Podoplanin Protein, Human (HEK293, His-Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Podoplanin Protein, Human (HEK293, His-Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Podoplanin Protein, Human (HEK293, His-Fc)
Cat. No.:
HY-P73378
Quantity:
MCE Japan Authorized Agent: