1. Recombinant Proteins
  2. Others
  3. Podoplanin Protein, Rat (HEK293, hFc)

The Podoplanin protein coordinates migration and adhesion by interacting with partners such as CLEC1B and CD9. It aids in blood vessel separation, platelet activation and platelet aggregation. Podoplanin Protein, Rat (HEK293, hFc) is the recombinant rat-derived Podoplanin protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Podoplanin Protein, Rat (HEK293, hFc) is 113 a.a., with molecular weight of ~38.6 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Podoplanin protein coordinates migration and adhesion by interacting with partners such as CLEC1B and CD9. It aids in blood vessel separation, platelet activation and platelet aggregation. Podoplanin Protein, Rat (HEK293, hFc) is the recombinant rat-derived Podoplanin protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Podoplanin Protein, Rat (HEK293, hFc) is 113 a.a., with molecular weight of ~38.6 kDa.

Background

Podoplanin, a multifaceted protein, orchestrates diverse cellular functions related to migration and adhesion through its interactions with various partners. In developmental processes, it contributes to the separation of blood and lymphatic vessels by binding CLEC1B, activating platelets, and inducing platelet activation or aggregation. Conversely, its interaction with CD9 attenuates platelet aggregation and pulmonary metastasis induced by Podoplanin. Furthermore, Podoplanin plays a crucial role in epithelial-mesenchymal transition (EMT) by promoting ERZ phosphorylation and triggering RHOA activation through interactions with MSN or EZR, leading to increased cell migration and invasiveness. Its binding with CD44 facilitates directional cell migration in epithelial and tumor cells. Within lymph nodes, Podoplanin controls fibroblastic reticular cells (FRCs) adhesion to the extracellular matrix (ECM) and actomyosin contraction by maintaining ERM proteins (EZR, MSN, and RDX) and MYL9 activation. Engagement with CLEC1B promotes FRC relaxation by blocking lateral membrane interactions. Additionally, Podoplanin participates in connecting lymphatic endothelium to the ECM through binding with LGALS8. In keratinocytes, it induces morphological changes, including an elongated shape and increased motility. Podoplanin also regulates invadopodia stability and maturation in tumor cells, influencing extracellular matrix degradation. Moreover, it is essential for normal lung cell proliferation and alveolus formation at birth. Podoplanin exhibits homodimeric structure and interacts with various proteins, including CLEC1B, CD9, LGALS8, HSPA9, CD44, MSN, EZR, and CCL21, playing a critical role in mediating diverse cellular functions.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Rat Podoplanin at 10 μg/mL (100 μL/well) can bind biotinylated Human CLEC2B. The ED50 for this effect is 0.4651 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Rat Podoplanin at 10 μg/mL (100 μL/well) can bind biotinylated Human CLEC2B. The ED50 for this effect is 0.4651 μg/mL.
Species

Rat

Source

HEK293

Tag

C-hFc

Accession

Q64294 (G23-L135)

Gene ID
Molecular Construction
N-term
Podoplanin (G23-L135)
Accession # Q64294
hFc
C-term
Synonyms
Podoplanin; T1-alpha; T1A; Type I cell 40 kDa protein; PDPN
AA Sequence

GAIGALEDDLVTPGPGDDMVNPGLEDRIETTDTTGELDKSTAKAPLVPTQPPIEELPTSGTSDHDHKEHESTTTVKAVTSHSTDKKTTHPNRDNAGGETQTTDKKDGLAVVTL

Molecular Weight

Approximately 55-70 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Podoplanin Protein, Rat (HEK293, hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Podoplanin Protein, Rat (HEK293, hFc)
Cat. No.:
HY-P74624
Quantity:
MCE Japan Authorized Agent: