1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins CAMK
  4. MAPK Family MAPKAPK
  5. MAPKAPK5/PRAK
  6. PRAK/MAPKAPK5 Protein, Human (sf9, His-GST)

PRAK/MAPKAPK5 protein, a serine/threonine kinase, responds to cellular stress and pro-inflammatory cytokines and acts as a tumor suppressor through MAP kinases (including MAPK1/ERK, MAPK14/p38-alpha, and MAPK11/p38-beta) activated by phosphorylation. Initially located in the nucleus, upon activation, it moves to the cytoplasm and phosphorylates the heat shock protein HSP27. PRAK/MAPKAPK5 Protein, Human (sf9, His-GST) is the recombinant human-derived PRAK/MAPKAPK5 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

PRAK/MAPKAPK5 protein, a serine/threonine kinase, responds to cellular stress and pro-inflammatory cytokines and acts as a tumor suppressor through MAP kinases (including MAPK1/ERK, MAPK14/p38-alpha, and MAPK11/p38-beta) activated by phosphorylation. Initially located in the nucleus, upon activation, it moves to the cytoplasm and phosphorylates the heat shock protein HSP27. PRAK/MAPKAPK5 Protein, Human (sf9, His-GST) is the recombinant human-derived PRAK/MAPKAPK5 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Background

The PRAK/MAPKAPK5 Protein, belonging to the serine/threonine kinase family, functions as a tumor suppressor and responds to cellular stress and proinflammatory cytokines by getting activated through phosphorylation by MAP kinases, including MAPK1/ERK, MAPK14/p38-alpha, and MAPK11/p38-beta. While initially located in the nucleus, upon phosphorylation and activation, it translocates to the cytoplasm. A notable target of this kinase is the heat shock protein HSP27, phosphorylating it at physiologically relevant sites. This gene displays two alternatively spliced transcript variants encoding distinct isoforms. PRAK/MAPKAPK5 exhibits ubiquitous expression, with discernible levels in the small intestine (RPKM 3.1), colon (RPKM 2.9), and 25 other tissues, emphasizing its widespread involvement in diverse physiological contexts across multiple organs.

Biological Activity

Measured by its ability to catalyze HSP27 tide synthetic substrate that incubate at 30℃ for 15 minutes. The specific activity is 42.004 nmo/min/mg.

Species

Human

Source

Sf9 insect cells

Tag

N-GST;N-His

Accession

Q8IW41-2/NP_003659.2 (M1-Q471)

Gene ID
Molecular Construction
N-term
His-GST
PRAK (M1-Q471)
Accession # NP_003659.2
C-term
Protein Length

Partial

Synonyms
MAP kinase-activated protein kinase 5; MAPKAP-K5; MK5; PRAK
AA Sequence

MSEESDMDKAIKETSILEEYSINWTQKLGAGISGPVRVCVKKSTQERFALKILLDRPKARNEVRLHMMCATHPNIVQIIEVFANSVQFPHESSPRARLLIVMEMMEGGELFHRISQHRHFTEKQASQVTKQIALALRHCHLLNIAHRDLKPENLLFKDNSLDAPVKLCDFGFAKIDQGDLMTPQFTPYYVAPQVLEAQRRHQKEKSGIIPTSPTPYTYNKSCDLWSLGVIIYVMLCGYPPFYSKHHSRTIPKDMRRKIMTGSFEFPEEEWSQISEMAKDVVRKLLKVKPEERLTIEGVLDHPWLNSTEALDNVLPSAQLMMDKAVVAGIQQAHAEQLANMRIQDLKVSLKPLHSVNNPILRKRKLLGTKPKDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGENEDEKLNEVMQEAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSHESQ

분자량

Approximately 35-45 kDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

선적

Shipping with dry ice.

각종 서류
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

PRAK/MAPKAPK5 Protein, Human (sf9, His-GST)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
PRAK/MAPKAPK5 Protein, Human (sf9, His-GST)
Cat. No.:
HY-P74621
수량:
MCE Japan Authorized Agent: