PTPMT1 Protein, Human (His)
Based on 1 Customer Validation
The PTPMT1 protein is a lipid phosphatase that critically regulates cellular lipid metabolism by dephosphorylating phosphatidylglycerolphosphate (PGP) to form phosphatidylglycerol (PG). This step is critical for the biosynthesis of cardiolipin, a key mitochondrial phospholipid that regulates membrane integrity and mitochondrial activity. PTPMT1 Protein, Human (His) is the recombinant human-derived PTPMT1 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The PTPMT1 protein is a lipid phosphatase that critically regulates cellular lipid metabolism by dephosphorylating phosphatidylglycerolphosphate (PGP) to form phosphatidylglycerol (PG). This step is critical for the biosynthesis of cardiolipin, a key mitochondrial phospholipid that regulates membrane integrity and mitochondrial activity. PTPMT1 Protein, Human (His) is the recombinant human-derived PTPMT1 protein, expressed by E. coli , with N-His labeled tag.
Background
PTPMT1 protein functions as a lipid phosphatase with a key role in cellular lipid metabolism. It catalyzes the dephosphorylation of phosphatidylglycerophosphate (PGP) to phosphatidylglycerol (PG), a crucial step in the biosynthetic pathway of cardiolipin—an essential mitochondrial phospholipid that regulates membrane integrity and mitochondrial activities. Beyond its lipid-related functions, PTPMT1 exhibits phosphatase activity toward phosphoprotein substrates, particularly involved in the dephosphorylation of mitochondrial proteins. This activity is crucial for ATP production and plays a role in the regulation of insulin secretion in pancreatic beta cells. Additionally, PTPMT1 is implicated in preventing intrinsic apoptosis, likely by regulating mitochondrial membrane integrity.
Verified Bioactivity
Measured by its ability to cleave pNPP. The specific activity is 666.88 pmoles/min/μg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q8WUK0-1 (K28-T201)
-
Molecular Construction
-
N-term
-
His
-
PTPMT1 (K28-T201)
Accession # Q8WUK0-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
PTPMT1; DUSP23; Protein Tyrosine Phosphatase Mitochondrial 1; Phosphoinositide Lipid Phosphatase; PLIP; NB4 Apoptosis/Differentiation Related Protein; MOSP; Protein-Tyrosine Phosphatase Mitochondrial 1; Phosphatidylglycerophosphatase And Protein-Tyrosine
-
AA Sequence
KVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARATKDGTFVISKT
-
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
