1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. PTPMT1 Protein, Human (His)

PTPMT1 Protein, Human (His)

Cat. No.: HY-P76556
COA Handling Instructions

The PTPMT1 protein is a lipid phosphatase that critically regulates cellular lipid metabolism by dephosphorylating phosphatidylglycerolphosphate (PGP) to form phosphatidylglycerol (PG). This step is critical for the biosynthesis of cardiolipin, a key mitochondrial phospholipid that regulates membrane integrity and mitochondrial activity. PTPMT1 Protein, Human (His) is the recombinant human-derived PTPMT1 protein, expressed by E. coli , with N-His labeled tag. The total length of PTPMT1 Protein, Human (His) is 174 a.a., with molecular weight of ~22 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $60 In-stock
10 μg $100 In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PTPMT1 protein is a lipid phosphatase that critically regulates cellular lipid metabolism by dephosphorylating phosphatidylglycerolphosphate (PGP) to form phosphatidylglycerol (PG). This step is critical for the biosynthesis of cardiolipin, a key mitochondrial phospholipid that regulates membrane integrity and mitochondrial activity. PTPMT1 Protein, Human (His) is the recombinant human-derived PTPMT1 protein, expressed by E. coli , with N-His labeled tag. The total length of PTPMT1 Protein, Human (His) is 174 a.a., with molecular weight of ~22 kDa.

Background

PTPMT1 protein functions as a lipid phosphatase with a key role in cellular lipid metabolism. It catalyzes the dephosphorylation of phosphatidylglycerophosphate (PGP) to phosphatidylglycerol (PG), a crucial step in the biosynthetic pathway of cardiolipin—an essential mitochondrial phospholipid that regulates membrane integrity and mitochondrial activities. Beyond its lipid-related functions, PTPMT1 exhibits phosphatase activity toward phosphoprotein substrates, particularly involved in the dephosphorylation of mitochondrial proteins. This activity is crucial for ATP production and plays a role in the regulation of insulin secretion in pancreatic beta cells. Additionally, PTPMT1 is implicated in preventing intrinsic apoptosis, likely by regulating mitochondrial membrane integrity.

Biological Activity

1.The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
2.Measured by its ability to cleave pNPP. The specific activity is 666.88 pmoles/min/μg.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q8WUK0 (K28-T201)

Gene ID
Molecular Construction
N-term
His
PTPMT1 (K28-T201)
Accession # Q8WUK0
C-term
Synonyms
Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1; PTPMT1; MOSP; PLIP
AA Sequence

KVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARATKDGTFVISKT

Molecular Weight

Approximately 22 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PTPMT1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PTPMT1 Protein, Human (His)
Cat. No.:
HY-P76556
Quantity:
MCE Japan Authorized Agent: