1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens Receptor Proteins
  3. Inhibitory Checkpoint Molecules Stimulatory Immune Checkpoint Molecules NK Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Cell Adhesion Molecules (CAMs)
  4. Immunoglobulin-like Cell Adhesion Molecules
  5. PVR/CD155
  6. PVR/CD155 Protein, Human (HEK293, His)

PVR/CD155 Protein, Human (HEK293, His)

Cat. No.: HY-P70807
COA Handling Instructions

PVR/CD155 Protein, Human (HEK293, His) is a recombinant Human PVR expressed in HEK 293 cells with a His tag at the N-terminus. PVR, Human plays a role in cancer cell invasion and migration.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $107 In-stock
50 μg $300 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

PVR/CD155 Protein, Human (HEK293, His) is a recombinant Human PVR expressed in HEK 293 cells with a His tag at the N-terminus. PVR, Human plays a role in cancer cell invasion and migration[1][2].

Background

PVR/CD155, also known as the human poliovirus receptor (PVR) is a member of the subfamily of immunoglobulin (Ig)-like molecules composed of an N-terminal variable-like, followed by two constant-like extracellular domains, a single transmembrane region and a cytoplasmic tail of variable length. CD155 binds the extracellular matrix protein vitronectin thereby mediating cell to matrix contacts. The cytoplasmic tail of CD155 interacts with the μ1B subunit of the clathrin adaptor complex resulting in directed transport of CD155 in polarized epithelial cells[1][2].

Biological Activity

Immobilized Human TIGIT-Fc at 5μg/mL (100 μL/well) can bind PVR/CD155 Protein, Human (HEK 293, His) and the ED50 is 10-30 ug/mL.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

NP_006496 (W21-N343)

Gene ID
Molecular Construction
N-term
PVR (W21-N343)
Accession # NP_006496
6*His
C-term
Synonyms
Poliovirus Receptor; Nectin-Like Protein 5; NECL-5; CD155; PVR; PVS
AA Sequence

WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGMSRN

Molecular Weight

Approximately 58.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PVR/CD155 Protein, Human (HEK293, His)
Cat. No.:
HY-P70807
Quantity:
MCE Japan Authorized Agent: