1. Recombinant Proteins
  2. PVR Protein, Human (HEK 293, His)

PVR Protein, Human (HEK 293, His)

Cat. No.: HY-P70807
Handling Instructions

PVR Protein, Human (HEK 293, His) is a recombinant Human PVR expressed in HEK 293 cells with a His tag at the N-terminus. PVR, Human plays a role in cancer cell invasion and migration[1][2].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $120 In-stock
Estimated Time of Arrival: December 31
50 μg $360 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
Poliovirus Receptor; Nectin-Like Protein 5; NECL-5; CD155; PVR; PVS
Species

Human

Source

HEK 293

Accession

NP_006496 (W21-N343)

Gene ID

5817

Molecular Weight

Approximately 58.0 kDa

AA Sequence

WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGMSRN

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Human TIGIT-Fc can bind Human PVR-His with an affinity constant of 4.22 nM.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C. It is stable at -20℃ for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Background

CD155, also known as the human poliovirus receptor (PVR) is a member of the subfamily of immunoglobulin (Ig)-like molecules composed of an N-terminal variable-like, followed by two constant-like extracellular domains, a single transmembrane region and a cytoplasmic tail of variable length. CD155 binds the extracellular matrix protein vitronectin thereby mediating cell to matrix contacts. The cytoplasmic tail of CD155 interacts with the μ1B subunit of the clathrin adaptor complex resulting in directed transport of CD155 in polarized epithelial cells[1][2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PVR Protein, Human (HEK 293, His)
Cat. No.:
HY-P70807
Quantity:
MCE Japan Authorized Agent: