RAB1B Protein, Human (HEK293, Fc)

The RAB1B protein is an important small GTPase that regulates intracellular membrane trafficking by coordinating vesicular processes through cycling between GDP and GTP forms. It recruits downstream effectors to achieve vesicle functions, including formation, movement, and fusion. RAB1B Protein, Human (HEK293, Fc) is the recombinant human-derived RAB1B protein, expressed by HEK293 , with N-hFc labeled tag. The total length of RAB1B Protein, Human (HEK293, Fc) is 199 a.a., with molecular weight of ~58 kDa.

The small GTPase Rab1B is a crucial regulator of intracellular membrane trafficking, orchestrating various stages from the formation of transport vesicles to their fusion with membranes. Operating through a cycle between an inactive GDP-bound form and an active GTP-bound form, Rab1B plays a pivotal role in recruiting downstream effectors responsible for vesicle processes, including formation, movement, tethering, and fusion. Notably, Rab1B contributes to the early stages of autophagic vacuole development, particularly at specialized regions of the endoplasmic reticulum. Additionally, it is involved in regulating vesicular transport between the endoplasmic reticulum and successive Golgi compartments, influencing the compacted morphology of the Golgi and facilitating the recruitment of lipid phosphatase MTMR6 to the endoplasmic reticulum-Golgi intermediate compartment.

Measured in a cell proliferation assay using A549 cells. The ED₅₀ for this effect is 3.355 ng/mL, corresponding to a specific activity is 2.98×10⁵ units/mg.

• 
  Measured in a cell proliferation assay using A549 cells. The ED₅₀ for this effect is 3.355 ng/mL, corresponding to a specific activity is 2.98×10⁵ units/mg.

Human

HEK293

N-hFc

Q9H0U4 (M1-G199)

81876  [NCBI]

MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGG

Approximately 58 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.