RAB1B Protein, Human (HEK293, Fc)
Based on 1 Customer Validation
The RAB1B protein is an important small GTPase that regulates intracellular membrane trafficking by coordinating vesicular processes through cycling between GDP and GTP forms. It recruits downstream effectors to achieve vesicle functions, including formation, movement, and fusion. RAB1B Protein, Human (HEK293, Fc) is the recombinant human-derived RAB1B protein, expressed by HEK293 , with N-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The RAB1B protein is an important small GTPase that regulates intracellular membrane trafficking by coordinating vesicular processes through cycling between GDP and GTP forms. It recruits downstream effectors to achieve vesicle functions, including formation, movement, and fusion. RAB1B Protein, Human (HEK293, Fc) is the recombinant human-derived RAB1B protein, expressed by HEK293 , with N-hFc labeled tag.
Background
The small GTPase Rab1B is a crucial regulator of intracellular membrane trafficking, orchestrating various stages from the formation of transport vesicles to their fusion with membranes. Operating through a cycle between an inactive GDP-bound form and an active GTP-bound form, Rab1B plays a pivotal role in recruiting downstream effectors responsible for vesicle processes, including formation, movement, tethering, and fusion. Notably, Rab1B contributes to the early stages of autophagic vacuole development, particularly at specialized regions of the endoplasmic reticulum. Additionally, it is involved in regulating vesicular transport between the endoplasmic reticulum and successive Golgi compartments, influencing the compacted morphology of the Golgi and facilitating the recruitment of lipid phosphatase MTMR6 to the endoplasmic reticulum-Golgi intermediate compartment.
Verified Bioactivity
Measured in a cell proliferation assay using A549 cells. The ED50 for this effect is 3.355 ng/mL, corresponding to a specific activity is 2.98×105 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-hFc
-
Accession
Q9H0U4 (M1-G199)
-
Molecular Construction
-
N-term
-
hFc
-
RAB1B (M1-G199)
Accession # Q9H0U4 -
C-term
-
-
Protein Length
Full Length of Ras-related protein Rab-1B Chain
-
Synonyms
RAB1B; Small GTP-Binding Protein; RAB1B, Member RAS Oncogene Family; Small Monomeric GTPase; Ras-Related Protein Rab-1B
-
AA Sequence
MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGG
-
Molecular Weight
Approximately 58 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
