RAC2 Protein, Human (His)
Based on 1 Customer Validation
The RAC2 protein is a plasma membrane-associated small GTPase that dynamically regulates cellular responses by cycling between an active GTP-bound state and an inactive GDP-bound state. In its active state, RAC2 regulates secretory function, phagocytosis, and epithelial cell polarization. RAC2 Protein, Human (His) is the recombinant human-derived RAC2 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The RAC2 protein is a plasma membrane-associated small GTPase that dynamically regulates cellular responses by cycling between an active GTP-bound state and an inactive GDP-bound state. In its active state, RAC2 regulates secretory function, phagocytosis, and epithelial cell polarization. RAC2 Protein, Human (His) is the recombinant human-derived RAC2 protein, expressed by E. coli , with N-His labeled tag.
Background
The RAC2 Protein, a plasma membrane-associated small GTPase, dynamically cycles between its active GTP-bound and inactive GDP-bound states, exerting pivotal regulatory control over various cellular responses. In its active state, RAC2 binds to diverse effector proteins, modulating processes such as secretory functions, phagocytosis of apoptotic cells, and epithelial cell polarization. Notably, RAC2 plays a crucial role in augmenting the production of reactive oxygen species (ROS) by NADPH oxidase. Its activity is intricately regulated by guanine nucleotide exchange factors (GEFs), facilitating the exchange of bound GDP for free GTP, GTPase-activating proteins (GAPs), which enhance GTP hydrolysis activity, and GDP dissociation inhibitors, which inhibit the dissociation of nucleotides from the GTPase. These regulatory mechanisms highlight the dynamic nature of RAC2 in orchestrating cellular processes and underscore its significance in the intricate balance of signaling cascades within the cell.
Verified Bioactivity
The specific activity was determined to be 8.58 nmol/min/mg in a GTPase-Glo assay using GTP solution substrate.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P15153 (M1-C189)
-
Molecular Construction
-
N-term
-
6*His
-
RAC2 (M1-C189)
Accession # P15153 -
C-term
-
-
Protein Length
Full Length of Ras-related C3 botulinum toxin substrate 2 Chain
-
Synonyms
RAC2; Ras-Related C3 Botulinum Toxin Substrate 3 (Rho Family, Small GTP-Binding Protein Rac2); Rac Family Small GTPase 2; Small Monomeric GTPase; EN-7; HSPC022; Ras-Related C3 Botulinum Toxin Substrate 2 (Rho Family, Small GTP Binding Protein Rac2); IMD73
-
AA Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRAC
-
Molecular Weight
Approximately 25 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)