1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. RAC2 Protein, Human (His)

RAC2 Protein, Human (His)

Cat. No.: HY-P74607
COA Handling Instructions

The RAC2 protein is a plasma membrane-associated small GTPase that dynamically regulates cellular responses by cycling between an active GTP-bound state and an inactive GDP-bound state. In its active state, RAC2 regulates secretory function, phagocytosis, and epithelial cell polarization. RAC2 Protein, Human (His) is the recombinant human-derived RAC2 protein, expressed by E. coli , with N-His labeled tag. The total length of RAC2 Protein, Human (His) is 189 a.a., with molecular weight of ~25 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $45 In-stock
10 μg $75 In-stock
50 μg $200 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The RAC2 protein is a plasma membrane-associated small GTPase that dynamically regulates cellular responses by cycling between an active GTP-bound state and an inactive GDP-bound state. In its active state, RAC2 regulates secretory function, phagocytosis, and epithelial cell polarization. RAC2 Protein, Human (His) is the recombinant human-derived RAC2 protein, expressed by E. coli , with N-His labeled tag. The total length of RAC2 Protein, Human (His) is 189 a.a., with molecular weight of ~25 kDa.

Background

The RAC2 Protein, a plasma membrane-associated small GTPase, dynamically cycles between its active GTP-bound and inactive GDP-bound states, exerting pivotal regulatory control over various cellular responses. In its active state, RAC2 binds to diverse effector proteins, modulating processes such as secretory functions, phagocytosis of apoptotic cells, and epithelial cell polarization. Notably, RAC2 plays a crucial role in augmenting the production of reactive oxygen species (ROS) by NADPH oxidase. Its activity is intricately regulated by guanine nucleotide exchange factors (GEFs), facilitating the exchange of bound GDP for free GTP, GTPase-activating proteins (GAPs), which enhance GTP hydrolysis activity, and GDP dissociation inhibitors, which inhibit the dissociation of nucleotides from the GTPase. These regulatory mechanisms highlight the dynamic nature of RAC2 in orchestrating cellular processes and underscore its significance in the intricate balance of signaling cascades within the cell.

Biological Activity

The specific activity was determined to be 8.58 nmol/min/mg in a GTPase-Glo assay using GTP solution substrate.

Species

Human

Source

E. coli

Tag

N-His

Accession

P15153 (M1-C189)

Gene ID
Molecular Construction
N-term
His
RAC2 (M1-C189)
Accession # P15153
C-term
Synonyms
Ras-related C3 botulinum toxin substrate 2; GX; Small G protein; p21-Rac2
AA Sequence

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRAC

Molecular Weight

Approximately 25 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

RAC2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RAC2 Protein, Human (His)
Cat. No.:
HY-P74607
Quantity:
MCE Japan Authorized Agent: