1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Superfamily Ligands
  5. TNF-β
  6. TNF-beta/TNFSF1 Protein, Human

TNF-beta/TNFSF1 Protein, Human

Cat. No.: HY-P7304
COA Handling Instructions

TNF-β (tumor necrosis factor β) also called lymphotoxin-α (LT-α), a member of the tumor necrosis factor superfamily, is a cytokine produced by lymphocytes. TNF-β activates the NF-κB signaling pathway, inducing cancer cell proliferation, invasion. TNF-β up-regulates genes connected with metastasis, promotes epithelial-to-mesenchymal-transition, stimulates its own expression. TNF-β mediates a large variety of inflammatory, immunostimulatory, and antiviral responses. TNF-beta/TNFSF1 Protein, Human is a recombinant protein consisting of 158 amino acids (L35-L205) and is produced in E. coli.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $72 In-stock
50 μg $200 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

TNF-β (tumor necrosis factor β) also called lymphotoxin-α (LT-α), a member of the tumor necrosis factor superfamily, is a cytokine produced by lymphocytes. TNF-β activates the NF-κB signaling pathway, inducing cancer cell proliferation, invasion[1][2]. TNF-β up-regulates genes connected with metastasis, promotes epithelial-to-mesenchymal-transition, stimulates its own expression[3]. TNF-β mediates a large variety of inflammatory, immunostimulatory, and antiviral responses. TNF-beta/TNFSF1 Protein, Human is a recombinant protein consisting of 158 amino acids (L35-L205) and is produced in E. coli.

Background

TNF-β is expressed by a variety of cells, including T cells, B cells and natural killer (NK) cells[1].
The amino acid sequence of human TNF beta protein has low homology between mouse and rat TNF alpha protein. While, rat TNF alpha shares 95.54% aa sequence identity with mouse TNF alpha protein.
TNF-β can be secreted and binds with high affinity to TNF receptors 1 and 2 (TNFR-1 and TNFR-2), and it is transiently expressed on the cell surfaces of activated B and T cells, where it forms a complex with LT-β as an LTα1β2 heterotrimer, activates NF-kB, MAPK, and PI3K/AKT pathways and induces cancer cells proliferation, invasion[1].
TNF-β is translated as a 25 kDa glycosylated polypeptide with 171 amino acid residues. TNF-β up-regulates of NF-κB signaling and activates of pro-inflammatory activity[1].TNF-β induces tumor cells proliferation, migration and increases the expression of p-p65, p-IkBα in a dose dependent manner[2].

In Vitro

TNF-β (human) (1, 10 ng/mL; 12 h; primary human chondrocytes) induces TNF-β and TNF-β-R expression on surface of chondrocytes and enhances adhesiveness to T lymphocytes when cocultured with T lymphocytes (Jurkat cells) for 4 h[1].
TNF-β (human) (1, 5, 10 ng/mL; 24 h) markedly stimulates HCT116 proliferation and migration in a dose dependent manner, and increases the expression of p-p65, p-IkBα in HCT116 cells in a dose dependent manner[2].

Biological Activity

The ED50 is <80 pg/mL as measured by L-929 mouse fibrosarcoma cells in the presence of the metabolic inhibitor actinomycin D, corresponding to a specific activity of >1.25 × 107 units/mg.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P01374 (L35-L205)

Gene ID
Molecular Construction
N-term
TNF-β (L35-L205)
Accession # P01374
C-term
Synonyms
rHuTNF-β; TNF-β; TNFSF1; Lymphotoxin-alpha
AA Sequence

LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

Molecular Weight

16-19 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

TNF-beta/TNFSF1 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TNF-beta/TNFSF1 Protein, Human
Cat. No.:
HY-P7304
Quantity:
MCE Japan Authorized Agent: