1. Recombinant Proteins
  2. TNF-beta Protein, Human

TNF-beta Protein, Human

Cat. No.: HY-P7304
Handling Instructions

TNF-beta Protein, Human exhibits anti-proliferative activity and causes the cellular destruction of tumor cell lines and performs a variety of important roles in immune regulation.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $390 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuTNF-β; TNF-β; TNFSF1; Lymphotoxin-alpha
Species

Human

Source

E. coli

Accession

P01374 (L35-L205)

Gene ID

4049

Molecular Weight

Approximately 18.6 kDa

AA Sequence

MLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

Biological Activity
The ED50 is <4 pg/mL as measured by L-929 mouse fibrosarcoma cells, corresponding to a specific activity of >2.5 × 108 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

As a signaling molecule, LT-α (TNF-β, Tumor Necrosis Factor beta) is involved in the regulation of cell survival, proliferation, differentiation, and apoptosis[1]. TNF-β plays an important role in innate immune regulation and its presence has been shown to prevent tumor growth and destroy cancerous cell lines[2]. In contrast, unregulated expression of TNF-β can result in a constantly active signaling pathway, thus leading to uncontrolled cellular growth and creation of tumors[1]. Hence depending on the context, TNF-β may function to prevent growth of cancer cells or facilitate the development of tumors. Furthermore, TNF-β effects depend on the type of organ it acts upon, type of cancer cells, cellular environment, gender, and time of effect during an immune response[2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TNF-beta Protein, Human
Cat. No.:
HY-P7304
Quantity:
MCE Japan Authorized Agent: