1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. RSPO2/R-Spondin 2 Protein, Human (HEK293, Fc)

RSPO2 is a key activator of the canonical Wnt pathway, serving as a ligand for LGR4-6 receptors and forming a complex with phosphorylated LRP6 and Frizzled receptors. This interaction activates the canonical Wnt pathway and increases target gene expression. RSPO2/R-Spondin 2 Protein, Human (HEK293, Fc) is the recombinant human-derived RSPO2/R-Spondin 2 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

RSPO2 is a key activator of the canonical Wnt pathway, serving as a ligand for LGR4-6 receptors and forming a complex with phosphorylated LRP6 and Frizzled receptors. This interaction activates the canonical Wnt pathway and increases target gene expression. RSPO2/R-Spondin 2 Protein, Human (HEK293, Fc) is the recombinant human-derived RSPO2/R-Spondin 2 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

RSPO2, a pivotal activator of the canonical Wnt signaling pathway, functions as a ligand for LGR4-6 receptors, particularly LGR4, LGR5, or LGR6. Upon binding to these receptors, the resultant complex associates with phosphorylated LRP6 and frizzled receptors, which are activated by extracellular Wnt receptors. This interaction triggers the canonical Wnt signaling pathway, leading to the increased expression of target genes. Additionally, RSPO2 serves as a regulator of both the canonical Wnt/beta-catenin-dependent pathway and the non-canonical Wnt signaling by acting as an inhibitor of ZNRF3, a crucial regulator of the Wnt signaling pathway. Notably, during embryonic development, RSPO2 plays a crucial role in limb specification by amplifying the Wnt signaling pathway independently of LGR4-6 receptors. This amplification occurs, possibly by RSPO2 acting as a direct antagonistic ligand to RNF43 and ZNRF3, thereby governing the number of limbs an embryo should form. RSPO2 interacts with WNT1, binds heparin, and interacts with LGR4, LGR5, and LGR6. Furthermore, RSPO2 engages with the E3 ubiquitin ligases RNF43 and ZNRF3, indicating its involvement in the intricate regulatory network of the Wnt signaling pathway.

Biological Activity

Measured by its ability to induce activation of β-catenin response in a Topflash Luciferase assay using HEK293T human embryonic kidney cells and the ED50 is typically 2-12 ng/mL in the presence of 5 ng/mL mouse Wnt3a.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q6UXX9-1 (Q22-G205, L186P)

Gene ID
Molecular Construction
N-term
RSPO2 (Q22-G205, L186P)
Accession # Q6UXX9-1
hFc
C-term
Protein Length

Partial

Synonyms
R-spondin-2; Roof plate-specific spondin-2; RSPO2
AA Sequence

QGNRWRRSKRASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLEETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPVKDTIPCPTIAESRRCKMTMRHCPG

Predicted Molecular Mass
48 kDa
Molecular Weight

Approximately 56 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of Histidine, Arginine, 120 mM NaCl, 0.02% Tween 80, 5% sucrose, pH 6.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

RSPO2/R-Spondin 2 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

RSPO2/R-Spondin 2 Protein, Human (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RSPO2/R-Spondin 2 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P76582
Quantity:
MCE Japan Authorized Agent: