1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. RSPO2/R-spondin-2 Protein, Mouse (HEK293, Fc)

RSPO2 is a key activator of the canonical Wnt pathway and acts as a ligand for LGR4-6 receptors (LGR4, LGR5, or LGR6). Upon binding, this complex forms with phosphorylated LRP6 and Frizzled receptors, activating the canonical Wnt pathway and upregulating target genes. RSPO2/R-spondin-2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived RSPO2/R-spondin-2 protein, expressed by HEK293 , with C-mFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RSPO2 is a key activator of the canonical Wnt pathway and acts as a ligand for LGR4-6 receptors (LGR4, LGR5, or LGR6). Upon binding, this complex forms with phosphorylated LRP6 and Frizzled receptors, activating the canonical Wnt pathway and upregulating target genes. RSPO2/R-spondin-2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived RSPO2/R-spondin-2 protein, expressed by HEK293 , with C-mFc labeled tag.

Background

RSPO2, a pivotal activator of the canonical Wnt signaling pathway, serves as a ligand for LGR4-6 receptors, namely LGR4, LGR5, or LGR6. Upon binding to these receptors, the formed complex associates with phosphorylated LRP6 and frizzled receptors activated by extracellular Wnt receptors, thereby initiating the canonical Wnt signaling pathway and leading to increased expression of target genes. Additionally, RSPO2 acts as a regulator of both the canonical Wnt/beta-catenin-dependent pathway and non-canonical Wnt signaling by inhibiting ZNRF3, a key regulator of the Wnt signaling pathway. This multifaceted protein may also function as a ligand for frizzled and LRP receptors. Notably, during embryonic development, RSPO2 plays a crucial role in limb specification by amplifying the Wnt signaling pathway independently of LGR4-6 receptors, potentially by acting as a direct antagonistic ligand to RNF43 and ZNRF3, thus influencing the formation of limbs in embryos. Interactions with WNT1, heparin, and LGR4, LGR5, and LGR6 underscore the complexity of RSPO2's involvement in Wnt signaling regulation.

Species

Mouse

Source

HEK293

Tag

C-mFc

Accession

Q8BFU0 (N24-G205)

Gene ID
Molecular Construction
N-term
RSPO2 (N24-G205)
Accession # Q8BFU0
mFc
C-term
Protein Length

Partial

Synonyms
R-spondin-2; Cristin-2; Roof plate-specific spondin-2
AA Sequence

NRWRRNKRASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLDETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPAKDTIPCPTIAESRRCKMAMRHCPG

Predicted Molecular Mass
47.4 kDa
Molecular Weight

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 85%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

RSPO2/R-spondin-2 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

RSPO2/R-spondin-2 Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RSPO2/R-spondin-2 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P76013
Quantity:
MCE Japan Authorized Agent: