RSPO2/R-spondin-2 Protein, Mouse (HEK293, Fc)

RSPO2 is a key activator of the canonical Wnt pathway and acts as a ligand for LGR4-6 receptors (LGR4, LGR5, or LGR6). Upon binding, this complex forms with phosphorylated LRP6 and Frizzled receptors, activating the canonical Wnt pathway and upregulating target genes. RSPO2/R-spondin-2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived RSPO2/R-spondin-2 protein, expressed by HEK293 , with C-mFc labeled tag.

RSPO2, a pivotal activator of the canonical Wnt signaling pathway, serves as a ligand for LGR4-6 receptors, namely LGR4, LGR5, or LGR6. Upon binding to these receptors, the formed complex associates with phosphorylated LRP6 and frizzled receptors activated by extracellular Wnt receptors, thereby initiating the canonical Wnt signaling pathway and leading to increased expression of target genes. Additionally, RSPO2 acts as a regulator of both the canonical Wnt/beta-catenin-dependent pathway and non-canonical Wnt signaling by inhibiting ZNRF3, a key regulator of the Wnt signaling pathway. This multifaceted protein may also function as a ligand for frizzled and LRP receptors. Notably, during embryonic development, RSPO2 plays a crucial role in limb specification by amplifying the Wnt signaling pathway independently of LGR4-6 receptors, potentially by acting as a direct antagonistic ligand to RNF43 and ZNRF3, thus influencing the formation of limbs in embryos. Interactions with WNT1, heparin, and LGR4, LGR5, and LGR6 underscore the complexity of RSPO2's involvement in Wnt signaling regulation.

Mouse

HEK293

C-mFc

Q8BFU0 (N24-G205)

239405  [NCBI]

Partial

NRWRRNKRASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLDETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPAKDTIPCPTIAESRRCKMAMRHCPG

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions.

≥ 85%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.