1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. RSPO3/R-spondin-3 Protein, Human (HEK293, Fc-His)

RSPO3/R-spondin-3 Protein, Human (HEK293, Fc-His)

Cat. No.: HY-P70557
COA Handling Instructions

RSPO3, a potent activator of the canonical Wnt pathway, binds to LGR4-6 receptors, initiating a complex with phosphorylated LRP6 and frizzled receptors. This interaction activates the canonical Wnt pathway, upregulating target genes. RSPO3, a multifaceted regulator, inhibits ZNRF3 and acts as a ligand for FZD8 and LRP6, potentially negatively regulating the TGF-beta pathway. In angiogenesis, RSPO3 controls vascular stability and pruning through the non-canonical Wnt pathway in endothelial cells. Notably, RSPO3 can amplify the Wnt pathway independently of LGR4-6 receptors, possibly by antagonizing RNF43 and ZNRF3. Interactions with FZD8, LRP6, WNT1, and LGR4-6 underscore its intricate role in Wnt signaling modulation. RSPO3/R-spondin-3 Protein, Human (HEK293, Fc-His) is the recombinant human-derived RSPO3/R-spondin-3 protein, expressed by HEK293, with C-hFc, C-6*His labeled tag. The total length of RSPO3/R-spondin-3 Protein, Human (HEK293, Fc-His) is 180 a.a., with molecular weight of ~61.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $125 In-stock
50 μg $350 In-stock
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RSPO3, a potent activator of the canonical Wnt pathway, binds to LGR4-6 receptors, initiating a complex with phosphorylated LRP6 and frizzled receptors. This interaction activates the canonical Wnt pathway, upregulating target genes. RSPO3, a multifaceted regulator, inhibits ZNRF3 and acts as a ligand for FZD8 and LRP6, potentially negatively regulating the TGF-beta pathway. In angiogenesis, RSPO3 controls vascular stability and pruning through the non-canonical Wnt pathway in endothelial cells. Notably, RSPO3 can amplify the Wnt pathway independently of LGR4-6 receptors, possibly by antagonizing RNF43 and ZNRF3. Interactions with FZD8, LRP6, WNT1, and LGR4-6 underscore its intricate role in Wnt signaling modulation. RSPO3/R-spondin-3 Protein, Human (HEK293, Fc-His) is the recombinant human-derived RSPO3/R-spondin-3 protein, expressed by HEK293, with C-hFc, C-6*His labeled tag. The total length of RSPO3/R-spondin-3 Protein, Human (HEK293, Fc-His) is 180 a.a., with molecular weight of ~61.0 kDa.

Background

R-Spondin 3 (RSPO3) serves as a potent activator of the canonical Wnt signaling pathway, acting as a ligand for LGR4-6 receptors and playing a pivotal role in angiogenesis regulation. Upon binding to LGR4-6 (LGR4, LGR5, or LGR6), the resulting complex associates with phosphorylated LRP6 and frizzled receptors, activated by extracellular Wnt receptors. This interaction triggers the canonical Wnt signaling pathway, leading to an upregulation of target gene expression. RSPO3 also acts as a multifaceted regulator by inhibiting ZNRF3, a crucial component of the Wnt signaling pathway, and serving as a ligand for frizzled FZD8 and LRP6. It may additionally exert negative regulation on the TGF-beta pathway. In the context of angiogenesis, RSPO3 emerges as a key player, controlling vascular stability and pruning by activating the non-canonical Wnt signaling pathway in endothelial cells. Remarkably, RSPO3 exhibits the capability to amplify the Wnt signaling pathway independently of LGR4-6 receptors, possibly through direct antagonistic interactions with RNF43 and ZNRF3. Interactions with the extracellular domain of FZD8 and LRP6, along with binding to WNT1 and LGR4, LGR5, and LGR6, underscore the intricate regulatory mechanisms orchestrated by RSPO3 in Wnt signaling modulation.

Species

Human

Source

HEK293

Tag

C-hFc;C-6*His

Accession

Q9BXY4 (Q22-V201)

Gene ID
Synonyms
R-spondin-3; RSPO3; Protein with TSP type-1 repeat; Roof plate-specific spondin-3; Thrombospondin type-1 domain-containing protein 2; PWTSR; THSD2; CRISTIN1
AA Sequence

QNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTV

Molecular Weight

Approximately 61.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

RSPO3/R-spondin-3 Protein, Human (HEK293, Fc-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RSPO3/R-spondin-3 Protein, Human (HEK293, Fc-His)
Cat. No.:
HY-P70557
Quantity:
MCE Japan Authorized Agent: