RSPO3/R-spondin-3 Protein, Human (HEK293, Fc-His)

RSPO3 is a potent activator of the canonical Wnt pathway and can bind to LGR4-6 receptors to initiate a complex with phosphorylated LRP6 and Frizzled receptors. This interaction activates the canonical Wnt pathway and upregulates target genes. RSPO3/R-spondin-3 Protein, Human (HEK293, Fc-His) is the recombinant human-derived RSPO3/R-spondin-3 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag.

R-Spondin 3 (RSPO3) serves as a potent activator of the canonical Wnt signaling pathway, acting as a ligand for LGR4-6 receptors and playing a pivotal role in angiogenesis regulation. Upon binding to LGR4-6 (LGR4, LGR5, or LGR6), the resulting complex associates with phosphorylated LRP6 and frizzled receptors, activated by extracellular Wnt receptors. This interaction triggers the canonical Wnt signaling pathway, leading to an upregulation of target gene expression. RSPO3 also acts as a multifaceted regulator by inhibiting ZNRF3, a crucial component of the Wnt signaling pathway, and serving as a ligand for frizzled FZD8 and LRP6. It may additionally exert negative regulation on the TGF-beta pathway. In the context of angiogenesis, RSPO3 emerges as a key player, controlling vascular stability and pruning by activating the non-canonical Wnt signaling pathway in endothelial cells. Remarkably, RSPO3 exhibits the capability to amplify the Wnt signaling pathway independently of LGR4-6 receptors, possibly through direct antagonistic interactions with RNF43 and ZNRF3. Interactions with the extracellular domain of FZD8 and LRP6, along with binding to WNT1 and LGR4, LGR5, and LGR6, underscore the intricate regulatory mechanisms orchestrated by RSPO3 in Wnt signaling modulation.

R-Spondin-3 enhances BMP-2-mediated differentiation of MC3T3-E1 cells. The ED₅₀ for this effect is 0.2479 µg/mL, corresponding to a specific activity is 4033.8846 U/mg.

• 
  R-Spondin-3 enhances BMP-2-mediated differentiation of MC3T3-E1 cells. The ED₅₀ for this effect is 0.2479 µg/mL, corresponding to a specific activity is 4033.8846 U/mg.

Human

HEK293

C-hFc;C-6*His

Q9BXY4-1 (Q22-V201)

84870  [NCBI]

Partial

QNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTV

Approximately 61-65 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.