S100A4 Protein, Mouse (His)
Based on 2 publication(s) in Google Scholar
The S100A4 protein, a calcium-binding protein, regulates cellular processes including motility, angiogenesis, differentiation, apoptosis, and autophagy.It interacts with MYH9 to enhance cell motility and chemotaxis.It modulates TP53 to reduce protein levels and stimulates cytokine production.S100A4 forms homodimers and interacts with PPFIBP1, ANXA2, TP53, CCR5, CXCR3, and FCGR3A, inhibiting FCGR3A phosphorylation.S100A4 Protein, Mouse (His) is the recombinant mouse-derived S100A4 protein, expressed by E.coli , with C-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The S100A4 protein, a calcium-binding protein, regulates cellular processes including motility, angiogenesis, differentiation, apoptosis, and autophagy.It interacts with MYH9 to enhance cell motility and chemotaxis.It modulates TP53 to reduce protein levels and stimulates cytokine production.S100A4 forms homodimers and interacts with PPFIBP1, ANXA2, TP53, CCR5, CXCR3, and FCGR3A, inhibiting FCGR3A phosphorylation.S100A4 Protein, Mouse (His) is the recombinant mouse-derived S100A4 protein, expressed by E.coli , with C-6*His labeled tag.
The S100A4 protein is a calcium-binding protein that plays a vital role in various cellular processes, including motility, angiogenesis, cell differentiation, apoptosis, and autophagy. It enhances cell motility and invasiveness by interacting with non-muscle myosin heavy chain IIA/MYH9, leading to filament depolymerization and increased soluble myosin-IIA levels, ultimately resulting in the formation of stable protrusions that facilitate chemotaxis. Additionally, it modulates the pro-apoptotic function of TP53 by binding to its C-terminal transactivation domain within the nucleus, leading to reduced TP53 protein levels. In the extracellular space, S100A4 stimulates cytokine production, such as granulocyte colony-stimulating factor and CCL24, from T-lymphocytes and acts as a chemoattractant complex with PGLYRP1 to promote lymphocyte migration via CCR5 and CXCR3 receptors. It forms homodimers and interacts with PPFIBP1, Annexin 2/ANXA2, TP53, CCR5, CXCR3, and FCGR3A, with the interaction with FCGR3A inhibiting PKC-dependent phosphorylation of FCGR3A.
Measured in a cell proliferation assay using U87 cells. The ED50 for this effect is 7.658 ng/mL, corresponding to a specific activity is 1.306×105 units/mg.
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
-
Biochim Biophys Acta Mol Basis Dis
S100A4 mediates the accumulation and functions of myeloid-derived suppressor cells via GP130/JAK2/STAT3 signaling in acute myeloid leukemia. [Abstract]2025 Jan;1871(1):167498. PMID: 39243827
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag C-6*His
-
Accession
P07091 (M1-K101)
-
Molecular Construction
-
N-term
-
S100A4 (M1-K101)
Accession # P07091 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
S100A4; Fibroblast-Specific Protein-1; Prev. CAPL; Murine Placental Homolog; Prev. MTS1; Protein S100-A4; PEL98; Metastasin 1; P9KA; Protein Mts1; 18A2; Calvasculin; FSP1; Leukemia Multidrug Resistance Associated Protein; 42A; Malignant Transformation Sup
-
AA Sequence
MARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK
-
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
