1. Recombinant Proteins
  2. Others
  3. S100A8 Protein, Rat (His)

S100A8 Protein, Rat (His)

Cat. No.: HY-P71275
SDS COA Handling Instructions

S100A8 protein functions as a danger signal in inflammation, activating innate immune cells by binding to receptors like Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER). This triggers signaling pathways that enhance the pro-inflammatory response. S100A8 Protein, Rat (His) is the recombinant rat-derived S100A8 protein, expressed by E. coli , with C-6*His labeled tag. The total length of S100A8 Protein, Rat (His) is 89 a.a., with molecular weight of ~13.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $120 In-stock
50 μg $360 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE S100A8 Protein, Rat (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

S100A8 protein functions as a danger signal in inflammation, activating innate immune cells by binding to receptors like Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER). This triggers signaling pathways that enhance the pro-inflammatory response. S100A8 Protein, Rat (His) is the recombinant rat-derived S100A8 protein, expressed by E. coli , with C-6*His labeled tag. The total length of S100A8 Protein, Rat (His) is 89 a.a., with molecular weight of ~13.0 kDa.

Background

S100A8 is a molecule that plays a role in inflammation and immune response. It acts as a danger signal and stimulates innate immune cells by binding to receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER). This binding activates signaling pathways that amplify the pro-inflammatory response.

Species

Rat

Source

E. coli

Tag

C-6*His

Accession

P50115 (M1-E89)

Gene ID
Molecular Construction
N-term
S100A8 (M1-E89)
Accession # P50115
6*His
C-term
Synonyms
Protein S100-A8; S100a8; Calgranulin-A; Chemotactic cytokine CP-10; Leukocyte L1 complex light chain; Migration inhibitory factor-related protein 8; MRP-8; Pro-inflammatory S100 cytokine; S100 calcium-binding protein A8; Caga; Mrp8
AA Sequence

MATELEKALSNVIEVYHNYSGIKGNHHALYRDDFRKMVTTECPQFVQNKNTESLFKELDVNSDNAINFEEFLVLVIRVGVAAHKDSHKE

Molecular Weight

Approximately 13.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

S100A8 Protein, Rat (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100A8 Protein, Rat (His)
Cat. No.:
HY-P71275
Quantity:
MCE Japan Authorized Agent: