SAE1 Protein, Human (GST)

SAE1 protein, forming a heterodimer, acts as an E1 ligase for SUMO1, SUMO2, SUMO3, and potentially SUMO4. It critically mediates ATP-dependent activation of SUMO proteins, enabling the formation of a thioester bond with UBA2/SAE2's active site cysteine. This process is essential for protein modification through sumoylation. SAE1 Protein, Human (GST) is the recombinant human-derived SAE1 protein, expressed by E. coli , with N-GST labeled tag. The total length of SAE1 Protein, Human (GST) is 346 a.a., with molecular weight of ~65.4 kDa.

The SAE1 protein functions as part of a heterodimer, serving as an E1 ligase for SUMO1, SUMO2, SUMO3, and likely SUMO4. It plays a crucial role in mediating ATP-dependent activation of SUMO proteins, facilitating the subsequent formation of a thioester bond between a SUMO protein and a conserved active site cysteine residue on UBA2/SAE2. This process is integral to protein modification through sumoylation.

Human

E. coli

N-GST

Q9UBE0 (M1-K346)

10055  [NCBI]

MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK

Approximately 65.4 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.