1. Recombinant Proteins
  2. Viral Proteins
  3. SARS-CoV Proteins
  4. SARS-CoV-2 S1 Protein (HEK293)

SARS-CoV-2 S1 Protein (HEK293)

Cat. No.: HY-P7436
Handling Instructions

SARS-CoV-2 S1 Protein (HEK293) is the recombinant S1 protein produced in HEK293 cells[1].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $140 In-stock
Estimated Time of Arrival: December 31
50 μg $420 In-stock
Estimated Time of Arrival: December 31
1 mg $3500 Get quote

* Please select Quantity before adding items.

SARS-CoV-2 S1 Protein (HEK293) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Virus

Source

HEK293

Tag

Tag Free

Accession

QHD43416.1 (Q14-R685)

Gene ID

N/A

Synonyms
2019-nCov RBD Protein; 2019-nCoV Spike RBD Protein; S protein RBD; 2019-nCoV S protein RBD
AA Sequence

QCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR

Molecular Weight

100-130 kDa

Biological Activity
Binding ability is measured by functional ELISA, 10 μg/mL (100 µL/well) of immoblized recombinant human ACE-2, Fc produces 50% optimal binding response approximately 1.18 μg/mL.
Appearance

Solution.

Formulation

Supplied as a 0.2 μm filter solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Background

The spike (S) glycoprotein of SARS-CoV-2 is a main target for neutralization antibody, uses ACE2 to enter host cells. SARS-CoV-2 S glycoprotein harbors a furin cleavage site at the boundary between the S1/S2 subunits, which is processed during biogenesis and sets this virus apart from SARS-CoV and SARS-related CoVs[1].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SARS-CoV-2 S1 Protein (HEK293)
Cat. No.:
HY-P7436
Quantity:
MCE Japan Authorized Agent: