1. Protéines recombinantes
  2. Viral Proteins
  3. SARS-CoV S Protein RBD (HEK293, Fc)

The SARS-CoV Spike glycoprotein (S) has three subunits S1, S2' and S2 through alternative splicing. S protein orchestrates viral entry by attaching the virion to the cell membrane through interactions with human ACE2 and CLEC4M/DC-SIGNR receptors. S protein also impairs target cell killing, cytokine production and down-regulates host tetherin (BST2), countering the antiviral activity of host. SARS-CoV S Protein RBD (HEK293, Fc) is the recombinant Virus-derived SARS-CoV S protein RBD, expressed by HEK293 , with C-mFc labeled tag.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Obtenir un devis  
100 μg   Obtenir un devis  

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing Use of Products
  • Activité biologique

  • Paramètres Techniques

  • Propriétés

  • Description

Description

The SARS-CoV Spike glycoprotein (S) has three subunits S1, S2' and S2 through alternative splicing. S protein orchestrates viral entry by attaching the virion to the cell membrane through interactions with human ACE2 and CLEC4M/DC-SIGNR receptors. S protein also impairs target cell killing, cytokine production and down-regulates host tetherin (BST2), countering the antiviral activity of host. SARS-CoV S Protein RBD (HEK293, Fc) is the recombinant Virus-derived SARS-CoV S protein RBD, expressed by HEK293 , with C-mFc labeled tag.

Background

The SARS-CoV Spike glycoprotein (S) has three subunits S1, S2' and S2 through alternative splicing. S1 can attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. S2' acts as a viral fusion peptide which is unmasked following S2 cleavage occurring upon virus endocytosis. S2 mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein.
Under the current model, S protein has at least three conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.
S protein orchestrates viral entry by attaching the virion to the cell membrane through interactions with human ACE2 and CLEC4M/DC-SIGNR receptors. It down-regulates host tetherin (BST2) via lysosomal degradation, countering its antiviral activity. Following attachment, internalization into host cell endosomes induces S glycoprotein conformational changes, potentially unmasking the fusion peptide of S2 through cathepsin CTSL proteolysis. S protein also impairs target cell killing and cytokine production[1][2].

Species

Virus

Source

HEK293

Tag

C-mFc

Accession

AAX16192.1 (R306-F527)

Gene ID

/

Molecular Construction
N-term
SARS-CoV S (R306-F527)
Accession # AAX16192.1
mFc
C-term
Protein Length

Partial

Synonyms
Spike glycoprotein; S glycoprotein; Peplomer protein; S
AA Sequence

RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF

Predicted Molecular Mass
51.4 kDa
Pureté

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

SARS-CoV S Protein RBD (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Vos produits récemment consultés:

Demande en ligne

Your information is safe with us. * Required Fields.

SARS-CoV S Protein RBD (HEK293, Fc)

 

Requested Quantity *

Nom du demandeur *

 

Civilité

Adresse e-mail *

 

Numéro de téléphone *

Department

 

Nom de l'organisation *

City

État

Country or Region *

     

Remarques

Bulk Inquiry

Inquiry Information

Nom du produit:
SARS-CoV S Protein RBD (HEK293, Fc)
Cat. No.:
HY-P73393
Quantité:
MCE Japan Authorized Agent: