1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. SDF-1/CXCL12
  6. SDF-1 Protein, Canine

SDF-1 (stromal cell-derived factor-1) is a homeostatic chemokine that binds CXCR4 and CXCR7 receptors and physiologically functions in hematopoiesis, leucocyte trafficking, cardiogenesis, and neurogenesis. SDF-1 is constitutively expressed in several organs including lung, liver, skeletal muscle, brain, kidney, heart, skin, and bone marrow. SDF-1 has an essential role in neural and vascular development, hematopoiesis, cancer and in immunity. SDF-1 Protein, Canine is produced in E. coli, and consists of 72 amino acids (K22-M93).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

SDF-1 (stromal cell-derived factor-1) is a homeostatic chemokine that binds CXCR4 and CXCR7 receptors and physiologically functions in hematopoiesis, leucocyte trafficking, cardiogenesis, and neurogenesis. SDF-1 is constitutively expressed in several organs including lung, liver, skeletal muscle, brain, kidney, heart, skin, and bone marrow. SDF-1 has an essential role in neural and vascular development, hematopoiesis, cancer and in immunity[1][2][3]. SDF-1 Protein, Canine is produced in E. coli, and consists of 72 amino acids (K22-M93).

Background

CXCL12 (SDF-1), is a small protein that belongs to the chemokine family, whose members have a crucial role in directing cell migration. It is ubiquitously expressed in many tissues and cell types. CXCL12 acts through two receptors, CXCR4 and CXCR7. While the former is a classic G protein-coupled transmembrane chemokine receptor, the latter primarily function as a scavenger of CXCL12. CXCL12 is a chemoattractant for T-lymphocytes and monocytes, but not neutrophils[1][2][3].
CXCL12 gene in human is located on chromosome 10 (10q11.21) and recognizes seven isoforms deriving from alternative gene splicing (α, β, γ, δ, ε, θ) with α and β being the most studied and three (CXCL12α to γ) in mice. CXCL12 is described classically as a homing chemokine as it exhibits chemoattraction of tumoral cells toward the target tissues. CXCL12, although being homeostatic in classification, also takes inflammatory activities. CXCL12 binds to glycosaminoglycans (GAGs) exposed on the surface of endothelial cells through a cluster of basic residues-the BBXB motif (B for basic amino acid and X any amino acid) generating its chemotactic gradients and promoting leukocyte/cancer cell migration. CXCL12/CXCR4 axis is involved in tumor progression, angiogenesis, metastasis, and survival. CXCR7 binds with high-affinity CXCL12 and with lower-affinity CXCL11. Although CXCR7 acts as a CXCL12 scavenger through ligand internalization and degradation, it transduces the signal mainly through β-arrestin with a pivotal role in endothelial and neural cells. CXCL12 is constitutively expressed in several organs including lung, liver, skeletal muscle, brain, kidney, heart, skin, and bone marrow. CXCL12 secretion is also associated with tissue damage such as heart infarct, limb ischemia, toxic liver damage, excessive bleeding, total body irradiation, and after tissue damage related to chemotherapy. CXCR4 is expressed by endothelial cells and pericytes of hypoxic, injured, or pathological tissues, including injured carotid arteries and atherosclerotic plaques[1][2].
CXCL12 has been considered as a standard pro-inflammatory molecule for a long time, as it attracts leukocytes to inflammatory sites and contributes to their activation. CXCL12 is very importantfor vascularization, hematopoiesis and neuronal development, but also for HIV-infection and cancer metastasis. CXCL12 plays a classic chemokine role in immune response by attracting activated, CXCR4+ T cells and monocytes to the sites of inflammation. However, CXCL12 plays an anti-inflammatory role in neuroinflammatory demyelinating disorders ofthe CNS, i.e. inmultiple sclerosis (MS) and its animal model experimental autoimmune encephalomyelitis (EAE). In addition, CXCL12 targeting affects tumor primary growth, mesenchymal transition, and migration but also shapes the tumor microenvironment (TME) toward immunoresponsive TME[1][2][3].

Biological Activity

Measured by its ability to chemoattract Jurkat human T cells. The ED50 for this effect is approximately ≤32.51 ng/mL , corresponding to a specific activity is ≥3.076×10^4 U/mg.

  • Measured by its ability to chemoattract Jurkat human T cells. The ED50 for this effect is approximately 29.01 ng/mL , corresponding to a specific activity is 3.447×104 U/mg.
Species

Canine

Source

E. coli

Tag

Tag Free

Accession

Q3LSL4 (K22-M93)

Gene ID
Molecular Construction
N-term
SDF-1 (K22-M93)
Accession # Q3LSL4
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Stromal Cell-Derived Factor 1; SDF-1; IRH; hIRH; PBSF; CXCL12; SDF1
AA Sequence

KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNSRQVCIDPKLKWIQEYLEKALNKRFKM

Predicted Molecular Mass
8.6 kDa
Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris, 500 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

SDF-1 Protein, Canine Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SDF-1 Protein, Canine

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SDF-1 Protein, Canine
Cat. No.:
HY-P74569
Quantity:
MCE Japan Authorized Agent: