Serpin A10 Protein, Mouse (HEK293, His)

Serpin A10 Protein, an inhibitor, regulates by inhibiting the activity of coagulation protease factor Xa in the presence of PROZ, calcium, and phospholipids. It also shows inhibitory effects on factor XIa even without cofactors, highlighting its versatility in modulating key components of the coagulation cascade. Serpin A10 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Serpin A10 protein, expressed by HEK293 , with C-His labeled tag. The total length of Serpin A10 Protein, Mouse (HEK293, His) is 427 a.a., with molecular weight of 60-80 kDa.

Serpin A10, functioning as an inhibitor, exerts its regulatory role by inhibiting the activity of the coagulation protease factor Xa in the presence of PROZ, calcium, and phospholipids. Additionally, it demonstrates inhibitory effects on factor XIa even in the absence of cofactors, showcasing its versatility in modulating key components of the coagulation cascade.

Measured by its ability to inhibit trypsin cleavage of a fluorogenic peptide substrate, Mca-RPKPVE-Nval-WRK(Dnp)-NH2. The IC₅₀ value is 27.513 nM, as measured under the described conditions.

Mouse

HEK293

C-His

Q8R121-1 (F22-L448)

217847  [NCBI]

FNLSSHSPEASVHLESQDYENQTWEEYTRTDPREEEEEEEEKEEGKDEEYWLRASQQLSNETSSFGFNLLRKISMRHDGNVIFSPFGLSVAMVNLMLGTKGETKVQIENGLNLQALSQAGPLILPALFKKVKETFSSNRDLGLSQGSFAFIHKDFDIKETYFNLSKKYFDIEYVSINFQNSSQARGLINHCIVKETEGKIPKLFDEINPETKLILVDYVLFKGKWLTPFDPSFTEADTFHLDKYRAIKVPMMYREGNFTSTFDKKFRCHILKLPYQGNATMLVVLMEKTGDYLALEDYLTVDLVETWLQNMKTRKMEVFFPKFKLNQRYEMHELLKQMGIRRLFSTSADLSELSAMARNLQVSRVLQQSVLEVDERGTEAVSGTLSEIIAYSMPPAIKVNRPFHFIIYEEMSRMLLFLGRVVNPTVL

Approximately 75-95 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.