Serpin A10 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
Serpin A10 Protein, an inhibitor, regulates by inhibiting the activity of coagulation protease factor Xa in the presence of PROZ, calcium, and phospholipids. It also shows inhibitory effects on factor XIa even without cofactors, highlighting its versatility in modulating key components of the coagulation cascade. Serpin A10 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Serpin A10 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Serpin A10 Protein, an inhibitor, regulates by inhibiting the activity of coagulation protease factor Xa in the presence of PROZ, calcium, and phospholipids. It also shows inhibitory effects on factor XIa even without cofactors, highlighting its versatility in modulating key components of the coagulation cascade. Serpin A10 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Serpin A10 protein, expressed by HEK293 , with C-His labeled tag.
Background
Serpin A10, functioning as an inhibitor, exerts its regulatory role by inhibiting the activity of the coagulation protease factor Xa in the presence of PROZ, calcium, and phospholipids. Additionally, it demonstrates inhibitory effects on factor XIa even in the absence of cofactors, showcasing its versatility in modulating key components of the coagulation cascade.
Verified Bioactivity
Measured by its ability to inhibit trypsin cleavage of a fluorogenic peptide substrate, Mca-RPKPVE-Nval-WRK(Dnp)-NH2. The IC50 value is 27.513 nM, as measured under the described conditions.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
Q8R121-1 (F22-L448)
-
Molecular Construction
-
N-term
-
Serpin A10 (F22-L448)
Accession # Q8R121 -
His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
SERPINA10; Protein-Z Dependent Proteinase Inhibitor; Serpin Family A Member 10; Protein Z-Dependent Protease Inhibitor; PZI; PZ-Dependent Protease Inhibitor; ZPI; Serpin A10; Serine (Or Cysteine) Proteinase Inhibitor, Clade A (Alpha-1 Antiproteinase, Anti
-
AA Sequence
FNLSSHSPEASVHLESQDYENQTWEEYTRTDPREEEEEEEEKEEGKDEEYWLRASQQLSNETSSFGFNLLRKISMRHDGNVIFSPFGLSVAMVNLMLGTKGETKVQIENGLNLQALSQAGPLILPALFKKVKETFSSNRDLGLSQGSFAFIHKDFDIKETYFNLSKKYFDIEYVSINFQNSSQARGLINHCIVKETEGKIPKLFDEINPETKLILVDYVLFKGKWLTPFDPSFTEADTFHLDKYRAIKVPMMYREGNFTSTFDKKFRCHILKLPYQGNATMLVVLMEKTGDYLALEDYLTVDLVETWLQNMKTRKMEVFFPKFKLNQRYEMHELLKQMGIRRLFSTSADLSELSAMARNLQVSRVLQQSVLEVDERGTEAVSGTLSEIIAYSMPPAIKVNRPFHFIIYEEMSRMLLFLGRVVNPTVL
-
Molecular Weight
Approximately 60-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
