Serpin A11 Protein, Mouse (HEK293, His)

Serpin A11 protein is a member of the serpin family and is an important serine protease inhibitor that regulates proteolytic activity. Its study deepens our understanding of cellular processes related to proteolysis and has potential applications in therapy. Serpin A11 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Serpin A11 protein, expressed by HEK293 , with C-His labeled tag.

The Serpin A11 Protein is an integral member of the serpin family, underscoring its crucial role as a serine protease inhibitor. As part of this family, Serpin A11 likely shares conserved structural and functional features with related proteins, signifying its involvement in regulating proteolytic activities. The classification within the serpin family emphasizes its specific designation within the broader context of serine protease inhibitors, offering insights into its unique mechanisms and substrate specificity. The study of Serpin A11 contributes to our understanding of its role in cellular processes related to proteolysis, providing potential applications in therapeutic interventions and a deeper comprehension of its broader impact on cellular processes involved in protein metabolism. Further exploration of Serpin A11's role holds promise for enhancing our knowledge of its contributions to both normal physiology and pathological conditions.

Mouse

HEK293

C-10*His

Q8CIE0 (Q22-G424)

380780  [NCBI]

Full Length of Mature Protein

QPFSAHGDKSLGASQPASHQSLEPAPAYHKVTPTITNFALRLYKQLAEEVAGNILFSPVSLSSSLALLSLGAHADTQTQILESLGFNLTETPAADVHRGFQSLLHTLDLPSPKLELKLGHSLFLDRQLKPQQRFLDSAKELYGALAFSANFTEAAATGQQINDLVRKQTYGQVVGCLPEFSHDTLMVLLNYIFFKAKWKHPFDRYQTRKQESFSLDQRTPLRIPMMRQKEMHRFLYDQEASCTVLQIEYSGTALLLLVLPDPGKMQQVEAALQPETLRRWGQRFLPSLLDLHLPRFSISATYNLEEILPLIGLGNLFDMEADLSGIMGQLNKTVSRVSHKAIVDMNEKGTEAAAASGLLSQPPALNMTSAPQAHYNRPFLLLLWEVTTQSLLFLGKVVNPAAG

Approximately 50-70 kDa due to the glycosylation.

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.