Copy Link Print Information

Serpin A6 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

Serpin A6 Protein serves as the primary transport protein for glucocorticoids and progestins in the blood of nearly all vertebrate species. Serpin A6 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Serpin A6 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Serpin A6 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for Serpin A6 Protein, Mouse (HEK293, His)
  • Serpin A6 Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Serpin A6 Protein serves as the primary transport protein for glucocorticoids and progestins in the blood of nearly all vertebrate species. Serpin A6 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Serpin A6 protein, expressed by HEK293 , with C-His labeled tag.

Background

Serpin A6, also known as corticosteroid-binding globulin (CBG), is a glycoprotein that acts as a carrier for corticosteroids, including cortisol, in the bloodstream. CBG plays a crucial role in regulating the levels and availability of corticosteroids, which are important for various physiological processes, including stress response, immune function, and metabolism. It binds to cortisol with high affinity, influencing its distribution and activity in the body. Mutations or alterations in the SERPINA6 gene can impact CBG function and corticosteroid homeostasis.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When Cortisol-BSA Conjugate is immobilized at 5 μg/mL, 100 μL/well can bind Recombinant Human Serpin A6. The ED50 for this effect is 5.447 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Cortisol-BSA Conjugate is immobilized at 5 μg/mL, 100 μL/well can bind Recombinant Human Serpin A6. The ED50 for this effect is 5.447 μg/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession

    Q06770 (V23-A397)

  • Gene ID
    12401  [NCBI]
  • Molecular Construction
    • N-term
    • Serpin A6 (V23-A397)
      Accession # Q06770
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    SERPINA6; Serpin Peptidase Inhibitor, Clade A (Alpha-1 Antiproteinase, Antitrypsin), Member 6; Prev. CBG; Serpin A6; Transcortin; Serpin Peptidase Inhibitor, Clade A (Alpha-1 Antiproteinase, Antitrypsin), Member 6, Isoform CRA_a; Serine (Or Cysteine) Prot

  • AA Sequence

    VTDEDSSSHRDLAPTNVDFAFNLYKRLVALNSDKNTLISPVSISMALAMLSLSTRGSTQYLENLGFNMSKMSEAEIHQGFQYLNSLLQQSDTGLEMNMGNVMFLLQNLKLKDSFLADTKHYYESEALTIPSKDWTKAGEQINNHVKNKTQGKIEHVVSDLDSSATLILINYIFLKGIWKLPFSPENTREEDFYVNETSTVKVPMMVQSGNISYFRDSAIPCQMVQMNYVGNGTTFIILPDQGQMDTVVAALNRDTIDRWGKLMIPRQMNLYIPKFSMSDTYDLQDVLADVGIKDLFTNQSDFADTTKDTPLTLTVLHKAMLQLDEGNVLPAATNGPPVHLPSESFTLKYNRPFIFLAFDKYTWSSLMMSQVMNPA

  • Molecular Weight

    Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. When Cortisol-BSA Conjugate is immobilized at 5 μg/mL, 100 μL/well can bind Recombinant Human Serpin A6. The ED50 for this effect is 5.447 μg/mL.

  • Serpin A6 Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Serpin A6 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for Serpin A6 Protein, Mouse (HEK293, His)
  • Serpin A6 Protein, Mouse (HEK293, His) Product Image