SH3PXD2A Protein, Human (Myc, His)
Based on 1 Customer Validation
SH3PXD2A is an adapter protein that plays a crucial role in the formation of invadopodia and podosomes, thereby enhancing the invasiveness of cancer cells. It interacts with ADAM, NOX and phosphoinositides and contributes to a variety of cellular processes. SH3PXD2A Protein, Human (Myc, His) is the recombinant human-derived SH3PXD2A protein, expressed by E. coli , with N-His, C-Myc labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SH3PXD2A is an adapter protein that plays a crucial role in the formation of invadopodia and podosomes, thereby enhancing the invasiveness of cancer cells. It interacts with ADAM, NOX and phosphoinositides and contributes to a variety of cellular processes. SH3PXD2A Protein, Human (Myc, His) is the recombinant human-derived SH3PXD2A protein, expressed by E. coli , with N-His, C-Myc labeled tag.
Background
SH3PXD2A, functioning as an adapter protein, plays a pivotal role in the formation of invadopodia and podosomes, contributing to extracellular matrix degradation and enhancing the invasiveness of certain cancer cells. This multifaceted protein establishes connections with matrix metalloproteinases (ADAMs), NADPH oxidases (NOXs), and phosphoinositides, thereby participating in diverse cellular processes. Acting as an organizer protein, SH3PXD2A facilitates NOX1- or NOX3-dependent reactive oxygen species (ROS) generation and ensures precise ROS localization. In collaboration with ADAM12, it mediates the neurotoxic effects induced by amyloid-beta peptide. The protein further interacts with CYBA, ADAM15, ADAM19, NOXO1, and NOXA1, forming a complex network of molecular associations. Notably, its interaction with FASLG underscores its involvement in intricate cellular signaling pathways.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His;C-Myc
-
Accession
Q5TCZ1 (P902-P986)
-
Molecular Construction
-
N-term
-
10*His
-
SH3PXD2A (P902-P986)
Accession # Q5TCZ1 -
Myc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
SH3PXD2A; Five SH3 Domain-Containing Protein; Prev. SH3MD1; Adapter Protein TKS5; FISH; TKS5; KIAA0418; SH3 Multiple Domains Protein 1; Tyrosine Kinase Substrate With Five SH3 Domains; Adaptor Protein TKS5; SH3 And PX Domain-Containing Protein 2A; Five SH
-
AA Sequence
PDPSGKELDTVPAKGRQNEGKSDSLEKIERRVQALNTVNQSKKATPPIPSKPPGGFGKTSGTPAVKMRNGVRQVAVRPQSVFVSP
-
Predicted Molecular Mass
14 kDa
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
