1. Recombinant Proteins
  2. CAR-T related Proteins CD Antigens Receptor Proteins
  3. Siglec family
  4. Siglec-2/CD22 Protein, Human (HEK293, His)

Siglec-2/CD22 Protein, Human (HEK293, His)

Cat. No.: HY-P72019
Handling Instructions

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
2 μg $62 In-stock
Estimated Time of Arrival: December 31
10 μg $168 In-stock
Estimated Time of Arrival: December 31
50 μg $504 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Siglec-2/CD22 Protein, Human (HEK293, His) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

HEK 293

Tag

C-6His

Accession

P20273 (R20-R687)

Gene ID

933

Synonyms
B-cell receptor CD22; BL-CAM; Siglec-2; CD22; SIGLEC2
AA Sequence

DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRR

Molecular Weight

Approximately 110 kDa

Purity

Greater than 94% as determined by SDS-PAGE.

Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized CD22 at 2 μg/mL can bind Anti-CD22 rabbit monoclonal antibody and the EC50 is 0.9875-1.661 ng/mL.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Siglec-2/CD22 Protein, Human (HEK293, His)
Cat. No.:
HY-P72019
Quantity:
MCE Japan Authorized Agent: