SLITRK4 Protein, Human (HEK293, His)

SLITRK4 Protein is pivotal in synaptogenesis, promoting synapse differentiation and synaptic maturation. Conversely, it suppresses neurite outgrowth, indicating a regulatory role in neuronal morphology. Interacting with PTPRD through its LRR 1 and 2 repeats, SLITRK4 suggests a potential role in modulating the activity or function of PTPRD, a receptor-type protein tyrosine phosphatase associated with neural development and synaptic plasticity. SLITRK4 Protein, Human (HEK293, His) is the recombinant human-derived SLITRK4 protein, expressed by HEK293 , with C-His labeled tag.

SLITRK4 plays a crucial role in synaptogenesis, actively promoting the differentiation of synapses, as evidenced by its involvement in synaptic maturation. Conversely, SLITRK4 suppresses neurite outgrowth, indicating a regulatory function in neuronal morphology. The protein interacts with PTPRD through its LRR 1 and 2 repeats, suggesting a potential role in modulating the activity or function of PTPRD, a receptor-type protein tyrosine phosphatase known for its involvement in neural development and synaptic plasticity.

Human

HEK293

C-His

Q8IW52 (D19-P616)

139065  [NCBI]

Extracellular Domain

DSDISVEICNVCSCVSVENVLYVNCEKVSVYRPNQLKPPWSNFYHLNFQNNFLNILYPNTFLNFSHAVSLHLGNNKLQNIEGGAFLGLSALKQLHLNNNELKILRADTFLGIENLEYLQADYNLIKYIERGAFNKLHKLKVLILNDNLISFLPDNIFRFASLTHLDIRGNRIQKLPYIGVLEHIGRVVELQLEDNPWNCSCDLLPLKAWLENMPYNIYIGEAICETPSDLYGRLLKETNKQELCPMGTGSDFDVRILPPSQLENGYTTPNGHTTQTSLHRLVTKPPKTTNPSKISGIVAGKALSNRNLSQIVSYQTRVPPLTPCPAPCFCKTHPSDLGLSVNCQEKNIQSMSELIPKPLNAKKLHVNGNSIKDVDVSDFTDFEGLDLLHLGSNQITVIKGDVFHNLTNLRRLYLNGNQIERLYPEIFSGLHNLQYLYLEYNLIKEISAGTFDSMPNLQLLYLNNNLLKSLPVYIFSGAPLARLNLRNNKFMYLPVSGVLDQLQSLTQIDLEGNPWDCTCDLVALKLWVEKLSDGIVVKELKCETPVQFANIELKSLKNEILCPKLLNKPSAPFTSPAPAITFTTPLGPIRSPPGGPVP

Approximately 85 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. /biology-dictionary/nci-h1993-cell.html  [Content Brief]