1. Recombinant Proteins
  2. Others
  3. SPARC Protein, Mouse (HEK293, His)

SPARC Protein, Mouse (HEK293, His)

Cat. No.: HY-P71086
COA Handling Instructions

SPARC proteins are components of chylomicrons, LDL, and VLDL and promote cellular binding and internalization of LDL particles. Interactions with various proteins, including PCSK9 and MTTP, contribute to its function. SPARC Protein, Mouse (HEK293, His) is the recombinant mouse-derived SPARC protein, expressed by HEK293 , with C-6*His labeled tag. The total length of SPARC Protein, Mouse (HEK293, His) is 285 a.a., with molecular weight of ~37 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $100 In-stock
50 μg $300 In-stock
100 μg $510 In-stock
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE SPARC Protein, Mouse (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SPARC proteins are components of chylomicrons, LDL, and VLDL and promote cellular binding and internalization of LDL particles. Interactions with various proteins, including PCSK9 and MTTP, contribute to its function. SPARC Protein, Mouse (HEK293, His) is the recombinant mouse-derived SPARC protein, expressed by HEK293 , with C-6*His labeled tag. The total length of SPARC Protein, Mouse (HEK293, His) is 285 a.a., with molecular weight of ~37 kDa.

Background

Apolipoprotein B-100 (ApoB) is a predominant protein component found in chylomicrons (apo B-48), LDL (apo B-100), and VLDL (apo B-100). Apo B-100 serves as a recognition signal for the cellular binding and internalization of LDL particles through the apoB/E receptor. Its interactions with various proteins contribute to its functional roles, such as binding with PCSK9 and MTTP. Additionally, ApoB interacts with AUP1 and plays a crucial role in the early secretory pathway's COPI vesicle-mediated retrograde transport, facilitating coatomer recruitment to membranes. It enhances the coatomer-dependent activity of ARFGAP2 and contributes to the specific retention of p24 complexes in cis-Golgi membranes. ApoB is implicated in organizing intracellular membranes, including the ER-Golgi intermediate compartment and the Golgi apparatus. Furthermore, it plays a role in the ER localization of PTPN2 isoform PTPB and is involved in interactions with other members of the EMP24/GP25L family, such as TMED2, TMED7, and TMED10. These interactions, along with associations with COPG1, PTPN2, SPAST, and STX17, contribute to ApoB's multifaceted involvement in vesicular protein trafficking and membrane organization within the cell.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P07214 (A18-I302)

Gene ID

20692  [NCBI]

Synonyms
SPARC; Sparc
AA Sequence

APQQTEVAEEIVEEETVVEETGVPVGANPVQVEMGEFEDGAEETVEEVVADNPCQNHHCKHGKVCELDESNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIAPCLDSELTEFPLRMRDWLKNVLVTLYERDEGNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALEEWAGCFGIKEQDINKDLVI

Molecular Weight

Approximately 37 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SPARC Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SPARC Protein, Mouse (HEK293, His)
Cat. No.:
HY-P71086
Quantity:
MCE Japan Authorized Agent: