SPARC Protein, Rat (HEK293, His)

SPARC protein is involved in the regulation of cell growth and may play a regulatory role by affecting the interaction of extracellular matrix and cytokines. SPRC protein can bind calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. It has two calcium binding sites: one is an acidic domain that can bind 5-8 Ca²⁺ with low affinity, and the other is an EF-hand loop that can bind Ca²⁺ ions with high affinity. SPARC Protein, Rat (HEK293, His) is the recombinant rat-derived SPARC protein, expressed by HEK293 , with C-His labeled tag.

SPARC protein is a cysteine-rich acidic secreted protein, also known as osteonectin or BM-40, and is a matricellular protein that regulates cell adhesion, extracellular matrix production, growth factor activity, and cell cycle. SPARC protein does not play a structural function, but has anti-proliferative and anti-adhesive properties that can regulate the interaction between cells and the surrounding extracellular matrix. SPRC protein is able to bind to Ca and Cu, several types of collagen, albumin, thrombospondin, PDGF, and cell membranes. It has two calcium binding sites: one is an acidic domain that can bind 5-8 Ca²⁺ with low affinity, and the other is an EF-hand ring that can bind Ca²⁺ ions with high affinity. SPARC is overexpressed in sites of injury, regeneration, obesity, cancer, and inflammation, and is a potential target and therapeutic indicator for disease treatment and evaluation.

Measured by its ability to inhibit the cell growth of Mv-1-Lu mink lung epithelial cells. The ED₅₀ for this effect is typically 3.581μg/mL, corresponding to a specific activity is 2.793×10² U/mg.

• 
  Measured by its ability to inhibit the cell growth of Mv-1-Lu mink lung epithelial cells. The ED₅₀ for this effect is typically 3.581 μg/mL, corresponding to a specific activity is 2.793×10² U/mg.

Rat

HEK293

C-His

P16975 (A18-I301)

24791  [NCBI]

Full Length of Mature Protein

APQTEAAEEMVAEETVVEETGLPVGANPVQVEMGEFEEGAEETVEEVVAENPCQNHHCKHGKVCELDESNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIAPCLDSELTEFPLRMRDWLKNVLVTLYERDEGNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALEEWAGCFGIKEQDINKDLVI

Approximately 40 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.