SPARC Protein, Rat (HEK293, His)

SPARC protein regulates cell growth through interactions with the extracellular matrix and cytokines. It binds calcium and copper, as well as various components like collagen types, albumin, thrombospondin, PDGF, and cell membranes. Notably, SPARC has two calcium binding sites, including an acidic domain binding 5 to 8 Ca(2+) ions with low affinity, and an EF-hand loop binding a Ca(2+) ion with high affinity. SPARC Protein, Rat (HEK293, His) is the recombinant rat-derived SPARC protein, expressed by HEK293 , with C-His labeled tag. The total length of SPARC Protein, Rat (HEK293, His) is 284 a.a., with molecular weight of ~33.8-40 kDa.

The SPARC protein is involved in the regulation of cell growth by interacting with the extracellular matrix and cytokines. It exhibits binding capabilities for calcium and copper, as well as various components such as different types of collagen, albumin, thrombospondin, PDGF, and cell membranes. Notably, it possesses two calcium binding sites, including an acidic domain that binds 5 to 8 Ca(2+) ions with low affinity, and an EF-hand loop that binds a Ca(2+) ion with high affinity.

Measured by its ability to inhibit the cell growth of Mv-1-Lu mink lung epithelial cells. The ED₅₀ for this effect is typically 3.581μg/mL, corresponding to a specific activity is 2.793×10² U/mg.

• 
  Measured by its ability to inhibit the cell growth of Mv-1-Lu mink lung epithelial cells. The ED₅₀ for this effect is typically 3.581 μg/mL, corresponding to a specific activity is 2.793×10² U/mg.

Rat

HEK293

C-His

P16975 (A18-I301)

24791  [NCBI]

APQTEAAEEMVAEETVVEETGLPVGANPVQVEMGEFEEGAEETVEEVVAENPCQNHHCKHGKVCELDESNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIAPCLDSELTEFPLRMRDWLKNVLVTLYERDEGNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALEEWAGCFGIKEQDINKDLVI

Approximately 33.8-40 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.