STK11 Protein, Human (His-SUMO)

Customer Review

Based on 1 Customer Validation

The STK11 protein is a tumor suppressor kinase that complexly regulates members of the AMP-activated protein kinase (AMPK) family, affecting cellular processes such as metabolism, apoptosis, and DNA damage responses. It phosphorylates the T-loop of AMPK family proteins and activates PRKAA1, PRKAA2 and other proteins (except MELK). STK11 Protein, Human (His-SUMO) is the recombinant human-derived STK11 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The STK11 protein is a tumor suppressor kinase that complexly regulates members of the AMP-activated protein kinase (AMPK) family, affecting cellular processes such as metabolism, apoptosis, and DNA damage responses. It phosphorylates the T-loop of AMPK family proteins and activates PRKAA1, PRKAA2 and other proteins (except MELK). STK11 Protein, Human (His-SUMO) is the recombinant human-derived STK11 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Background

STK11 Protein, a tumor suppressor serine/threonine-protein kinase, intricately regulates the activity of AMP-activated protein kinase (AMPK) family members, exerting influence over diverse cellular processes including metabolism, cell polarity, apoptosis, and the DNA damage response. Operating through the phosphorylation of the T-loop of AMPK family proteins, such as PRKAA1, PRKAA2, BRSK1, BRSK2, MARK1, MARK2, MARK3, MARK4, NUAK1, NUAK2, SIK1, SIK2, SIK3, and SNRK, STK11 facilitates their activation while excluding MELK. Beyond the AMPK family, STK11 extends its regulatory reach to non-AMPK proteins like STRADA, PTEN, and possibly p53/TP53. Functioning as a pivotal upstream regulator of AMPK, STK11 orchestrates cellular responses including the inhibition of growth-promoting signaling pathways during low energy conditions, maintenance of glucose homeostasis in the liver, initiation of autophagy in nutrient-deprived cells, and facilitation of B-cell differentiation in the germinal center in response to DNA damage. Additionally, STK11 plays a crucial role in cellular polarity by remodeling the actin cytoskeleton and is essential for cortical neuron polarization through the phosphorylation and activation of BRSK1 and BRSK2. In the realm of DNA damage response, STK11 interacts with p53/TP53, participating in transcription activation on the CDKN1A/WAF1 promoter, and acts as a mediator of p53/TP53-dependent apoptosis. Furthermore, STK11 is implicated in UV radiation-induced DNA damage response by phosphorylating CDKN1A in collaboration with NUAK1, contributing to its degradation for optimal DNA repair, and it also plays a role in spermiogenesis.

Verified Bioactivity

1.The kinase activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
2.Immobilized Human STK11 at 2 μg/mL (100 μL/well) can bind STK11 antibody, The ED50 for this effect is 8.246 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-SUMO;N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • STK11 (M1-C430)
      Accession # Q15831
    • C-term
  • Protein Length

    Full Length of Serine/threonine-protein kinase STK11 Chain

  • Synonyms

    STK11; Serine/Threonine Kinase 11 (Peutz-Jeghers Syndrome); Serine/Threonine Kinase 11; Non-Specific Serine/Threonine Protein Kinase; LKB1; Serine/Threonine-Protein Kinase LKB1; PJS; Serine/Threonine-Protein Kinase PLK1; Serine/Threonine-Protein Kinase ST

  • AA Sequence

    MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIRRLSAC

  • Predicted Molecular Mass

    64.3 kDa

  • Molecular Weight

    Approximately 60 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00