1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Serine/Threonine Kinase Proteins
  4. Serine/Threonine-Protein Kinase 11
  5. STK11 Protein, Human (His-SUMO)

STK11 Protein, Human (His-SUMO)

Cat. No.: HY-P71549
COA Handling Instructions

The STK11 protein is a tumor suppressor kinase that complexly regulates members of the AMP-activated protein kinase (AMPK) family, affecting cellular processes such as metabolism, apoptosis, and DNA damage responses. It phosphorylates the T-loop of AMPK family proteins and activates PRKAA1, PRKAA2 and other proteins (except MELK). STK11 Protein, Human (His-SUMO) is the recombinant human-derived STK11 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of STK11 Protein, Human (His-SUMO) is 430 a.a., with molecular weight (affected by relative charge) of ~72 KDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg $158 In-stock
10 μg $269 In-stock
50 μg $753 Get quote
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The STK11 protein is a tumor suppressor kinase that complexly regulates members of the AMP-activated protein kinase (AMPK) family, affecting cellular processes such as metabolism, apoptosis, and DNA damage responses. It phosphorylates the T-loop of AMPK family proteins and activates PRKAA1, PRKAA2 and other proteins (except MELK). STK11 Protein, Human (His-SUMO) is the recombinant human-derived STK11 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of STK11 Protein, Human (His-SUMO) is 430 a.a., with molecular weight (affected by relative charge) of ~72 KDa.

Background

STK11 Protein, a tumor suppressor serine/threonine-protein kinase, intricately regulates the activity of AMP-activated protein kinase (AMPK) family members, exerting influence over diverse cellular processes including metabolism, cell polarity, apoptosis, and the DNA damage response. Operating through the phosphorylation of the T-loop of AMPK family proteins, such as PRKAA1, PRKAA2, BRSK1, BRSK2, MARK1, MARK2, MARK3, MARK4, NUAK1, NUAK2, SIK1, SIK2, SIK3, and SNRK, STK11 facilitates their activation while excluding MELK. Beyond the AMPK family, STK11 extends its regulatory reach to non-AMPK proteins like STRADA, PTEN, and possibly p53/TP53. Functioning as a pivotal upstream regulator of AMPK, STK11 orchestrates cellular responses including the inhibition of growth-promoting signaling pathways during low energy conditions, maintenance of glucose homeostasis in the liver, initiation of autophagy in nutrient-deprived cells, and facilitation of B-cell differentiation in the germinal center in response to DNA damage. Additionally, STK11 plays a crucial role in cellular polarity by remodeling the actin cytoskeleton and is essential for cortical neuron polarization through the phosphorylation and activation of BRSK1 and BRSK2. In the realm of DNA damage response, STK11 interacts with p53/TP53, participating in transcription activation on the CDKN1A/WAF1 promoter, and acts as a mediator of p53/TP53-dependent apoptosis. Furthermore, STK11 is implicated in UV radiation-induced DNA damage response by phosphorylating CDKN1A in collaboration with NUAK1, contributing to its degradation for optimal DNA repair, and it also plays a role in spermiogenesis.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-SUMO;N-6*His

Accession

Q15831 (M1-C430)

Gene ID
Molecular Construction
N-term
6*His-SUMO
STK11 (M1-C430)
Accession # Q15831
C-term
Synonyms
hLKB1; Liver kinase B1; LKB1; PJS; Polarization related protein LKB1; Renal carcinoma antigen NY-REN-19; Serine/Threonine Kinase 11; Serine/threonine protein kinase 11; Serine/threonine protein kinase LKB1; Serine/threonine protein kinase STK11; Serine/threonine-protein kinase 11; Serine/threonine-protein kinase LKB1; Serine/threonine-protein kinase XEEK1; Stk11; STK11_HUMAN
AA Sequence

MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIRRLSAC

Molecular Weight

Approximately 72 kDa. The reducing (R) protein migrat es as 72 kDa in SDS-PAGE may be due to relative charge.

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm sterile filtered 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

STK11 Protein, Human (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
STK11 Protein, Human (His-SUMO)
Cat. No.:
HY-P71549
Quantity:
MCE Japan Authorized Agent: