1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC chemokine subfamily
  5. TARC/CCL17 Protein, Human (HEK293, His)

TARC/CCL17 Protein, Human (HEK293, His)

Cat. No.: HY-P7759
Handling Instructions

TARC/CCL17 Protein, Human (HEK293, His) is a member of the CC chemokine family, and is highly expressed by thymus and other cells. The effect of CCL17 is mediated by the chemokine receptor CCR4.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $90 In-stock
Estimated Time of Arrival: December 31
50 μg $270 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

TARC/CCL17 Protein, Human (HEK293, His) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

HEK 293

Accession

Q92583 (A24-S94)

Gene ID

6361

Synonyms
rHuCCL17, His; C-C motif chemokine 17; CC chemokine TARC; Small-inducible cytokine A17; Thymus and activation-regulated chemokine; CCL17; SCYA17; TARC
AA Sequence

ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERSHHHHHH

Molecular Weight

Approximately 13 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM Tris,150 mM NaCl, pH8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

The C-C class chemokines 17 (CCL17) and its C-C chemokine receptor 4 (CCR4) have been shown to play an important role in homeostasis and inflammatory responses. CCL17/TARC acts as a chemoattractant, which primarily aids the recruitment of CD4+ T regulatory cells and Th2, in addition to Th17 cells. The effect of CCL17/TARC is mediated by the chemokine receptor CCR4. CCL17 mRNA is expressed constitutively in thymus tissue and transiently in stimulated peripheral blood mononuclear cells. CCL17 induced chemotaxis and Ca2+ influx in the cells stably expressing CCR4, thereby demonstrating the ligand-receptor relationship between CCL17 and CCR4[1][2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TARC/CCL17 Protein, Human (HEK293, His)
Cat. No.:
HY-P7759
Quantity:
MCE Japan Authorized Agent: