TFPI2 Protein, Human (HEK293, His)

The critical role of the TFPI2 protein in regulating plasmin-mediated matrix remodeling suggests its involvement in extracellular matrix dynamics. It inhibits trypsin, plasmin, factor VIIa/tissue factor and weak factor Xa, affecting coagulation and fibrinolysis. TFPI2 Protein, Human (HEK293, His) is the recombinant human-derived TFPI2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TFPI2 Protein, Human (HEK293, His) is 191 a.a., with molecular weight of 18-33 kDa.

The TFPI2 protein may have a crucial role in the regulation of plasmin-mediated matrix remodeling, suggesting its involvement in the intricate processes that govern extracellular matrix dynamics. TFPI2 exhibits inhibitory effects on trypsin, plasmin, factor VIIa/tissue factor, and weakly on factor Xa, indicating its potential influence on various proteolytic activities involved in coagulation and fibrinolysis. Notably, TFPI2 does not affect thrombin. It is found in a complex with ABCB1, TFPI2, and PPP2R3C, leading to the dephosphorylation of ABCB1. This complex formation hints at potential regulatory mechanisms involving TFPI2 in modulating the phosphorylation state of ABCB1, which could have broader implications for cellular processes. Further exploration into the specific mechanisms and downstream effects of TFPI2's inhibitory functions and its interactions within the ABCB1-containing complex could provide valuable insights into its multifaceted role in the regulation of hemostasis and matrix remodeling.

Human

HEK293

C-6*His

P48307 (D23-K213)

7980  [NCBI]

DAAQEPTGNNAEICLLPLDYGPCRALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTGCGGNDNNFVSREDCKRACAKALK

18-33 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.