TGF alpha/TGFA Protein, Human

TGF-alpha Protein, Human is a 50-amino-acid polypeptide that binds to the epidermal growth factor (EGF) receptor and stimulates cell growth.

Transforming growth factor alpha (TGF-α) is a principal molecule in the normal and neoplastic development of the mammary gland. Binding of TGF-α to the epidermal growth factor receptor (EGFR), activates the EGFRs' endogenous tyrosine kinase activity and stimulates growth of the epithelium in the virgin and pregnant mouse mammary gland. TGF-α expression can be detected in breast cancer cells in vivo and in vitro and overexpression can elicit partial transformation or immortalized human and rodent mammary epithelial cells^[1][2].

The ED₅₀ is <0.2 ng/mL as measured by BALB/c 3T3 cells, corresponding to a specific activity of >5 × 10⁶ units/mg.

Human

E. coli

Tag Free

P01135 (V40-A89)

7039  [NCBI]

Full Length of TGFA

VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA

Approximately 6 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/ht-1080-cell.html  [Content Brief]

  [2]. Nilsson O, et al. Expression of transforming growth factor alpha and its receptor in human neuroendocrine tumours. Int J Cancer. 1995 Mar 3;60(5):645-51.  [Content Brief]

  [3]. Lupia E, et al. Thrombopoietin as biomarker and mediator of cardiovascular damage in critical diseases. Mediators Inflamm. 2012;2012:390892.  [Content Brief]