1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily Neurotrophic Factors
  4. TGF-β
  5. TGF-β3
  6. TGF beta 3/TGFB3 Protein, Human (HEK293)

TGF-β3 (transforming growth factor-β3) is a member of a TGF­-beta superfamily subgroup that performs many cellular functions. TGF-β3 has a role in embryogenesis and cell differentiation. TGF-β3 also plays a critical role in palatogenesis, the wound healing process. TGF-β3 is capable of binding directly to the type II receptor (TβRII). TGF beta 3/TGFB3 Protein, Human (HEK293) is produced in HEK293 cells, and consists of 112 amino acids (A301-S412).

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
10 μg En stock
50 μg En stock
100 μg En stock
> 100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products

    TGF beta 3/TGFB3 Protein, Human (HEK293) purchased from MCE. Usage Cited in: Adv Funct Mater. 2025 Jan 05.

    The release kinetics of TGF-β3 Protein (50 μg/mL; PBS) from SBPSPL-T and SBPSP-LT hydrogels were studied. TGF-β3 Protein exhibited a burst release in the SBPSPT-L hydrogel throughout the incubation period, with 73.32 ± 1.10% of TGF-β3 Protein released within the first 7 days. In contrast, the SBPSP-LT group showed an initial burst release followed by a sustained and slower release over 3 to 21 days.

    TGF beta 3/TGFB3 Protein, Human (HEK293) purchased from MCE. Usage Cited in: Adv Funct Mater. 2025 Jan 05.

    The loading and encapsulation efficiencies of TGF-β3 (50 μg/mL; PBS) were determined to be 9.98 ± 0.12 % and 99.83 ± 0.10 %, respectively, as assessed by ELISA.

    TGF beta 3/TGFB3 Protein, Human (HEK293) purchased from MCE. Usage Cited in: Adv Funct Mater. 2025 Jan 05.

    The gene expression level of osteogenic and chondrogenic-associated genes was measured with RT-PCR at day 21. SBPSP-LT hydrogel can significantly enhance the osteochondrogenic differentiation of BMSCs by sequential delivery of TGF-β3 Protein (50 μg/mL; PBS) /Mg2+.

    TGF beta 3/TGFB3 Protein, Human (HEK293) purchased from MCE. Usage Cited in: J Ethnopharmacol. 2026 Feb 28:357:120922.  [Abstract]

    The effects of different concentrations of TGF-β3 Protein (5, 10, 15 ng/mL; 24 h) on the number of autophagosomes and autolysosomes in RTE cells.

    TGF beta 3/TGFB3 Protein, Human (HEK293) purchased from MCE. Usage Cited in: J Ethnopharmacol. 2026 Feb 28:357:120922.  [Abstract]

    The effects of different concentrations of TGF-β3 Protein (5, 10, 15 ng/mL; 24 h) on the LC3-II/LC3-I ratio and the levels of Beclin1, ATG-5, and P62 protein in RTE cells were determined by Western blot. The LC3-II/LC3-I ratio, Beclin1 level, and ATG-5 level increased in a concentration-dependent manner as the concentration of TGF-β3 Protein increased, whereas P62 expression exhibited a downward trend.
    • Actividad biológica

    • Technical Parameters

    • Properties

    • Descripciòn

    • Referencias

    Descripciòn

    TGF-β3 (transforming growth factor-β3) is a member of a TGF­-beta superfamily subgroup that performs many cellular functions. TGF-β3 has a role in embryogenesis and cell differentiation. TGF-β3 also plays a critical role in palatogenesis, the wound healing process. TGF-β3 is capable of binding directly to the type II receptor (TβRII)[1][2]. TGF beta 3/TGFB3 Protein, Human (HEK293) is produced in HEK293 cells, and consists of 112 amino acids (A301-S412).

    Background

    Three TGF-β isoforms have been found in mammals: TGF-β1, 2, and 3, which are structurally and functionally similar. TGF-β3 is important in embryonic development, scarless repair of injury in the embryo, adult wound healing and tissue homeostasis. It has an important role in regulating cell migration, angiogenesis, epithelial-mesenchymal transition, apoptosis, modulation of immune function, extracellular matrix (ECM) production and the regulation of ECM remodelling; biological processes that are often required for tumour growth and maintenance[1][2].
    As with all members of the family, TGF-β3 is highly conserved across species, with mouse, rat and human TGF-β3 demonstrating >97% sequence homology.
    TGF-β3 is released from LAP by integrins: integrin-binding results in distortion of the LAP chain and subsequent release of the active TGF-β3. TGF-β3 is capable of binding directly to the type II receptor (TβRII). TGF-β3 expression increases in fetal wound healing and reduces fibronectin and collagen I and III deposition, and also improves the architecture of the neodermis. Fibroblasts are key cells in the wound healing process. In addition, TGF-β3 may actually play a protective role against tumourigenesis in a range of tissues including the skin, breast, oral and gastric mucosa. TGF-β3 is a more potent inhibitor of DNA synthesis in human keratinocytes compared to TGF-β1 and TGF-β2. TGF-β3 mRNA is expressed in lymphocytes such as CD4+ T cells, CD8+ T cells, γδT cells, and B cells. TGF-β3 has the potential to regulate systemic autoimmune diseases by inhibiting B cells. Moreover, during palatogenesis, TGF-β3 is supposed to transduce signals via both canonical Smad-dependent and non-canonical Smad-independent signaling. In human B cells, TGF-β3 induces phosphorylation of Smad1/5 along with Smad2 and Smad3[1][2][3].
    TGF-β3 is involved in cell differentiation, embryogenesis and development. TGF-β3 is crucial in tissue regeneration and scarless tissue repair. TGF-β3 is also involved in palatogenesis, chondrogenesis, and pulmonary development. Furthermore, TGF-β3 plays a role in cancer and immune diseases[1][2][3].

    In Vitro

    Recombinant TGF-β3 (0.01-10 ng/mL) induces fibronectin expression in leiomyoma cells and directly stimulates leiomyoma cell proliferation[4].
    Recombinant TGF-β3 (0.5 ng/mL) promotes mRNA expression, and increased protein levels of osteocalcin (OCN) and type I collagen (COL I) in mouse pulpal mesenchymal cells. TGF-β3 also induces the expression of dentin sialophosphoprotein and dentin matrix protein 1[5].
    Recombinant TGF-β3 (0.005-3 ng/mL) adds to rat Sertoli cells cultured in vitro on Matrigel-coated bicameral units perturbed the inter-Sertoli tight junction (TJ) permeability barrier dose-dependently. Moreover, the presence of TGF-β3 also inhibits the transient and/or basal expression of several TJ-associated proteins, which include occludin, zonula occludens-1, and claudin-11 when inter-Sertoli TJs are being assembled in vitro[8].

    In Vivo

    Recombinant TGF-β3 (1 μg/kg; i.p; once every week) decelerates the progress of radiation-induced pulmonary fibrosis and hindered the recruitment of fibrocytes to lung in radiation-induced mouse pulmonary fibrosis[6].
    Recombinant TGF-β3 (local infiltration (0.5 μg, 1.0 μg, 2.5 μg, and 50 μg) or intravenous application (500 μg/kg); for 7 days) treatment accelerates gastric ulcer healing in rats[7].

    Actividad biológica

    1.The ED50 is <0.2 ng/mL as measured in a cell proliferation assay using mouse HT-2 cells.
    2.Measured by its ability to inhibit the IL-4-dependent proliferation of TF-1 mouse T cells. The ED50 for this effect is 10-80 pg/mL.
    3.Measured by its ability to inhibit the IL-4-dependent proliferation of TF-1 human erythroleukemic cells. The ED50 for this effect is 10-80 pg/mL.

    Species

    Human

    Source

    HEK293

    Tag

    Tag Free

    Accession

    P10600-1 (A301-S412)

    Gene ID
    Molecular Construction
    N-term
    TGFB3 (A301-S412)
    Accession # P10600-1
    C-term
    Protein Length

    Full Length of Mature TGFB3

    Synonyms
    rHuTGF-β3; TGFB3; LAP
    AA Sequence

    ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS

    Predicted Molecular Mass
    12.7 kDa
    Peso molecular

    Approximately 12-14 kDa, based on SDS-PAGE under reducing conditions.

    Pureza

    ≥ 95%, as determined by reducing SDS-PAGE.

    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of 4 mM HCl.
    2.Lyophilized from a 0.22 μm filtered solution of 50 mM Glycine-HCl, 150 mM NaCl, pH 2.5.
    Please refer to the lot-specific COA for specific buffer information.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Envío

    Room temperature in continental US; may vary elsewhere.

    Documentación
    Referencias
    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Productos vistos recientemente:

    Consulta en línea

    Your information is safe with us. * Required Fields.

    TGF beta 3/TGFB3 Protein, Human (HEK293)

     

    Requested Quantity *

    Nombre del solicitante *

     

    Saludo

    Direcciòn del E-mail *

     

    Número de teléfono *

    Department

     

    Nombre de la Organizaciòn *

    City

    Provincia

    Country or Region *

         

    Observaciones

    Consulta para venta a granel

    Inquiry Information

    Nombre del producto:
    TGF beta 3/TGFB3 Protein, Human (HEK293)
    Cat. No.:
    HY-P7120
    Cantidad:
    MCE Japan Authorized Agent: