1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily Neurotrophic Factors
  4. TGF-β
  5. TGF-β2
  6. TGF beta 2/TGFB2 Protein, Human (HEK293)

Transforming growth factor-beta 2 (TGF-β2), an extracellular glycosylated protein, is a member of the TGF-β superfamily. TGFβ2 controls key physiological processes including cell migration, proliferation and differentiation via signalling through type I and type II receptors (TGFβR1 and TGFβR2). TGF-β2 is an immune suppressor involved in the development of immune tolerance, and also regulates embryonic development. TGF beta 2/TGFB2 Protein, Human (HEK293) is produced in HEK293 cells, and consists of 112 amino acids (A303-S414).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

    TGF beta 2/TGFB2 Protein, Human (HEK293) purchased from MCE. Usage Cited in: Theranostics. 2025 Jan 1;15(2):745-765.  [Abstract]

    qRT-PCR showing the transcript levels of PIM1 in HUVEC, MAEC and MPLEC treated with H2O2 (200 μM) and TGF-β (50 ng/mL, 48 h).

    TGF beta 2/TGFB2 Protein, Human (HEK293) purchased from MCE. Usage Cited in: Theranostics. 2025 Jan 1;15(2):745-765.  [Abstract]

    Representative Western blot images and quantification of PIM1, PIM1, ZO-1, ZEB1, CD31, N-Cadherin, VE-Cadherin, Vimentin, α-SMA, Slug, Snail and TAGLN levels in HUVEC, MAEC and MPLEC treated with H2O2 (200 μM) and TGF-β (50 ng/mL, 48 h).

    TGF beta 2/TGFB2 Protein, Human (HEK293) purchased from MCE. Usage Cited in: Theranostics. 2025 Jan 1;15(2):745-765.  [Abstract]

    Endothelial scratch wound healing assays and Transwell assay were performed, showing that PIM1 silenced attenuated migration of HUVEC induced by H2O2 (200 μM) and TGF-β (50 ng/mL).

    TGF beta 2/TGFB2 Protein, Human (HEK293) purchased from MCE. Usage Cited in: Theranostics. 2025 Jan 1;15(2):745-765.  [Abstract]

    Fluorescence localization and quantification of NDRG1 (Green) in HUVEC and MAEC pretreated with siNC or siPIM1-1, siPIM1-2 and stimulated with H2O2 (200 μM) and TGF-β (50 ng/mL, 48 h).

    TGF beta 2/TGFB2 Protein, Human (HEK293) purchased from MCE. Usage Cited in: Genes Dis. 2022 May 26;10(2):505-520.  [Abstract]

    Effects of TGF-β on the mRNA expression of m6A methylases METTL3 in RPE cells (ARPE-19). ARPE-19 cells were treated with TGF-β2 (20 ng/ml, MedChemexpress) for 24 h, and total RNA was isolated to analyze the expression of the genes by real-time PCR. The expression of METTL3 was significantly inhibited by adding TGF-β compared with control (t-test, ∗∗P < 0.01).
    • Biological Activity

    • Technical Parameters

    • Properties

    • Documentation

    • References

    Description

    Transforming growth factor-beta 2 (TGF-β2), an extracellular glycosylated protein, is a member of the TGF-β superfamily. TGFβ2 controls key physiological processes including cell migration, proliferation and differentiation via signalling through type I and type II receptors (TGFβR1 and TGFβR2). TGF-β2 is an immune suppressor involved in the development of immune tolerance, and also regulates embryonic development[1][2]. TGF beta 2/TGFB2 Protein, Human (HEK293) is produced in HEK293 cells, and consists of 112 amino acids (A303-S414).

    Background

    In mammals, three different isoforms of TGF-β are described (TGF-β1, TGF-β2 and TGF-β3; transforming growth factor beta) to regulate apoptosis, proliferation, differentiation, migration and invasion processes utilising overlapping but not redundant mechanisms. All three isoforms are expressed in the liver, but their expression is differentially distributed among liver cell types. TGF-β2 expression in different liver cell types and is also associated with developmental defects and fibrotic diseases in mice[1][2][3].
    The sequence of amino acids in TGF-β2 proteins from different species is very stable, which leads to the conclusion that in the process of evolution, TGF-β2 has been only slightly altered, and that both in humans and in animals, its function is similar.
    TGFβ2 is a transforming growth factor beta (TGFB) family cytokine, with members of this cytokine family playing broad regulatory roles and controlling key physiological processes including cell migration, proliferation and differentiation via signalling through type I and type II receptors (TGFβR1 and TGFβR2), with signals propagating via the downstream regulatory SMAD proteins. This TGFβ/SMAD pathway is frequently dysregulated in human cancer. TGFβ cytokines are capable of suppressing T cell growth in response to IL‐2. The degree of TGFβ2 expression correlated with the expression of several different markers of immune cell subsets within tumours. In addition, TGF-β2 regulates embryonic development and, therefore not surprisingly, global Tgfb2 null mice exhibit a wide range of developmental defects and perinatal mortality[1][2][3].
    TGF-β2 is an immune suppressor involved in the development of immune tolerance, and recombinant TGF-β2 incubation is more potent than TGF-β1 or TGF-β3 in suppressing macrophage inflammatory responses. TGF-β2 is shown to correlate with bad prognosis in intrahepatic CCAs and hepatocellular carcinoma. Mechanistically, canonical Smad signalling as well as crosstalk with Yap, Hippo, Wnt and β-catenin signalling have been demonstrated in the liver and other organs[1][2][3].

    In Vitro

    Recombinant human TGF-β2 (1.25, 2.5, 5, 10, and 20 ng/mL; for 24 h) increases extracellular matrix (ECM) protein synthesis and secretion in optic nerve head (ONH) astrocytes and lamina cribrosa (LC) cells. TGF-β2 induces phosphorylation of canonical signaling proteins Smad2/3 but does not alter phosphorylation of non-canonical signaling proteins ERK1/2, p38, and JNK1/2 proteins in ONH astrocytes and LC cells[4].

    Biological Activity

    1.The ED50 is <0.2 ng/mL as measured by mouse HT-2 cells.
    2.Measured by its ability to inhibit the IL-4-dependent proliferation of TF-1 cells.The ED50 for this effect is 30-180 pg/mL.

    • Measured by its ability to inhibit the IL-4-dependent proliferation of HT‑2 mouse T cells. The ED50 for this effect is 0.096 ng/mL, corresponding to a specific activity is 1.04×107 units/mg.
    Species

    Human

    Source

    HEK293

    Tag

    Tag Free

    Accession

    P61812-1 (A303-S414)

    Gene ID
    Molecular Construction
    N-term
    TGFB2 (A303-S414)
    Accession # P61812-1
    C-term
    Protein Length

    Full Length of Mature TGFB2

    Synonyms
    TGF-beta-2; Cetermin; G-TSF; TGFB2; Polyergin; rHuTGF-β2
    AA Sequence

    ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS

    Predicted Molecular Mass
    12.7 kDa
    Molecular Weight

    Approximately 13 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

    Glycosylation
    Yes
    Purity
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    Lyophilized after extensive dialysis against 4 mM HCl.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Documentation
    References
    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    TGF beta 2/TGFB2 Protein, Human (HEK293)

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    TGF beta 2/TGFB2 Protein, Human (HEK293)
    Cat. No.:
    HY-P7119
    Quantity:
    MCE Japan Authorized Agent: