1. Recombinant Proteins
  2. TGFB2 Protein, Human

TGFB2 Protein, Human

Cat. No.: HY-P7119
Handling Instructions

TGFB2 Protein, Human is a multifunctional cytokine which participates in control of cell growth and differentiation, induces fibrosis, causes the suppression of immune response and has a vital role during embryonic development.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $790 In-stock
Estimated Time of Arrival: December 31
100 μg $1050 In-stock
Estimated Time of Arrival: December 31
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
TGF-beta-2; Cetermin; G-TSF; TGFB2; Polyergin; rHuTGF-β2
Species

Human

Source

HEK 293

Accession

P61812 (A303-S414)

Gene ID

7042

Molecular Weight

Approximately 12.7 kDa

AA Sequence

ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS

Biological Activity
The ED50 is <0.2 ng/mL as measured by mouse HT-2 cells.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 4 mM HCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

TGFβ is released from degranulating platelets and secreted by all of the major cell types participating in the repair process, including lymphocytes, macrophages, endothelial cells, smooth muscle cells, epithelial cells, and fibroblasts. Mammals express three isoforms of TGFβ designated TGFβI, TGFβ2, and TGFβ3; TGFβ1 is the most abundant isoform in all tissues, and in human platelets it is the only isoform of the peptide. Certain cells such as retinal pigment epithelial cells secrete predominantly TGFβ2, and certain body fluids such as the aqueous and vitreous of the eye, amniotic fluid, saliva, and breast milk contain principally TGFβ2. TGFβ3 is the least studied of the TGFβ isoforms. It has been isolated from human umbilical cord and is secreted from certain cells, including myoblast celllines; however, it is usually less abundant than either TGFβ1 or TGFβ2 in both tissue and cell extracts[1]. Transforming Growth Factor β2 mediates various cell-cell interactions that occur during embryonic development. It is previously shown that Transforming Growth Factor β2 mRNA is expressed at chondrogenic sites in the developing limb. When Transforming Growth Factor β2-soaked beads are implanted in the limb bud, extra digits are induced, and mice lacking Transforming Growth Factor β2 has minor skeletal defects in the limb[2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TGFB2 Protein, Human
Cat. No.:
HY-P7119
Quantity:
MCE Japan Authorized Agent: