TGFBR2/TGF-beta RII Protein, Human (sf9, His)

The TGFBR2/TGF-β RII protein cooperates with TGFBR1 to form dedicated receptors for TGFB1, TGFB2, and TGFB3. It serves as a signal transducer that coordinates diverse physiological and pathological processes, including cell cycle regulation, mesenchymal cell dynamics, wound healing, matrix production, immunosuppression, and carcinogenesis. TGFBR2/TGF-beta RII Protein, Human (sf9, His) is the recombinant human-derived TGFBR2/TGF-beta RII protein, expressed by Sf9 insect cells , with C-His labeled tag. The total length of TGFBR2/TGF-beta RII Protein, Human (sf9, His) is 144 a.a., with molecular weight of ~24 kDa.

The transmembrane serine/threonine kinase, TGFBR2 (TGF-beta RII), collaborates with the TGF-beta type I serine/threonine kinase receptor, TGFBR1, to form the dedicated receptor for TGF-beta cytokines, including TGFB1, TGFB2, and TGFB3. Functioning as a signal transducer, TGFBR2 mediates the transmission of TGFB1, TGFB2, and TGFB3 signals from the cell surface to the cytoplasm, thereby orchestrating a diverse array of physiological and pathological processes. These include cell cycle arrest in epithelial and hematopoietic cells, regulation of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression, and carcinogenesis. The receptor complex, comprising 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer, leads to the phosphorylation and activation of TGFBR1 by the constitutively active TGFBR2. Activated TGFBR1 subsequently phosphorylates SMAD2, causing its dissociation from the receptor and interaction with SMAD4. The resulting SMAD2-SMAD4 complex translocates to the nucleus, where it modulates the transcription of TGF-beta-regulated genes, constituting the canonical SMAD-dependent TGF-beta signaling cascade. Additionally, TGFBR2 participates in non-canonical, SMAD-independent TGF-beta signaling pathways and exhibits transforming growth factor beta-activated receptor activity.

Measured by its binding ability in a functional ELISA. Immobilized TGFBR2 at 10 μg/mL (100 μL/well) can bind TGFB1-His and the EC₅₀ is 130-300 ng/mL.

Human

Sf9 insect cells

C-His

P37173 (T23-Q166)

7048  [NCBI]

TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQ

Approximately 24 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 20 mM PBS, 150 mM NaCl, 10 % glycerol, 0.5 mM TCEP, pH 7.0.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.