TGFBR2/TGF-beta RII Protein, Human (sf9, His)
Based on 1 Customer Validation
The TGFBR2/TGF-β RII protein cooperates with TGFBR1 to form dedicated receptors for TGFB1, TGFB2, and TGFB3. It serves as a signal transducer that coordinates diverse physiological and pathological processes, including cell cycle regulation, mesenchymal cell dynamics, wound healing, matrix production, immunosuppression, and carcinogenesis. TGFBR2/TGF-beta RII Protein, Human (sf9, His) is the recombinant human-derived TGFBR2/TGF-beta RII protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The TGFBR2/TGF-β RII protein cooperates with TGFBR1 to form dedicated receptors for TGFB1, TGFB2, and TGFB3. It serves as a signal transducer that coordinates diverse physiological and pathological processes, including cell cycle regulation, mesenchymal cell dynamics, wound healing, matrix production, immunosuppression, and carcinogenesis. TGFBR2/TGF-beta RII Protein, Human (sf9, His) is the recombinant human-derived TGFBR2/TGF-beta RII protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
The transmembrane serine/threonine kinase, TGFBR2 (TGF-beta RII), collaborates with the TGF-beta type I serine/threonine kinase receptor, TGFBR1, to form the dedicated receptor for TGF-beta cytokines, including TGFB1, TGFB2, and TGFB3. Functioning as a signal transducer, TGFBR2 mediates the transmission of TGFB1, TGFB2, and TGFB3 signals from the cell surface to the cytoplasm, thereby orchestrating a diverse array of physiological and pathological processes. These include cell cycle arrest in epithelial and hematopoietic cells, regulation of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression, and carcinogenesis. The receptor complex, comprising 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer, leads to the phosphorylation and activation of TGFBR1 by the constitutively active TGFBR2. Activated TGFBR1 subsequently phosphorylates SMAD2, causing its dissociation from the receptor and interaction with SMAD4. The resulting SMAD2-SMAD4 complex translocates to the nucleus, where it modulates the transcription of TGF-beta-regulated genes, constituting the canonical SMAD-dependent TGF-beta signaling cascade. Additionally, TGFBR2 participates in non-canonical, SMAD-independent TGF-beta signaling pathways and exhibits transforming growth factor beta-activated receptor activity.
Verified Bioactivity
1.This product does not contain protein kinase domain.
2.Measured by its binding ability in a functional ELISA. Immobilized TGFBR2 at 10 μg/mL (100 μL/well) can bind TGFB1-His and the EC50 is 130-300 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
P37173-1 (T23-Q166)
-
Molecular Construction
-
N-term
-
TGFBR2 (T23-Q166)
Accession # P37173-1 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
TGFBR2; Transforming Growth Factor, Beta Receptor II Gamma; Prev. MFS2; Transforming Growth Factor, Beta Receptor II Beta; TGF-Beta Type II Receptor; Serine/Threonine-Protein Kinase Receptor; TGF-Beta Receptor Type-2; Receptor Protein Serine/Threonine Kinase; TBR-Ii; TGF-Beta Receptor Type IIB; TGFR-2; TGF-Beta Receptor Type II; TBRII; TGFbeta-RII; Transforming Growth Factor, Beta Receptor II (70/80kDa); LDS1B; Transforming Growth Factor-Beta Receptor Type II; LDS2B; Transforming Growth Factor Beta Receptor II; TAAD2; TbetaR-II; AAT3; Transforming Growth Factor, Beta Receptor II Epsilon; FAA3; Transforming Growth Factor, Beta Receptor II Alpha; LDS2; Transforming Growth Factor, Beta Receptor II Delta; RIIC; Transforming Growth Factor Beta Receptor 2; Transforming Growth Factor Beta Receptor Type IIC
-
AA Sequence
TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQ
-
Predicted Molecular Mass
17.8 kDa
-
Molecular Weight
Approximately 20-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 20 mM PBS, 150 mM NaCl, 10 % glycerol, 0.5 mM TCEP, pH 7.0.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)