TGFBR2/TGF-beta RII Protein, Mouse (HEK293, Fc)

TGFBR2/TGF-beta RII Protein, Mouse (HEK293, Fc), a fragment of transforming growth factor-beta receptor type 2 (TβRII), consists of amino acid of Ile24-Asp159 with a 6His tag at the C-terminus.

Transforming growth factor β (TGF-β) plays an important role in normal development and homeostasis. Dysregulation of TGF-β responsiveness and its downstream signaling pathways contribute to many diseases, including cancer initiation, progression, and metastasis. TGF-β ligands bind to three isoforms of the TGF-β receptor (TGFBR) with different affinities. TGFBRI and II are both serine/threonine and tyrosine kinases, but TGFBRIII does not have any kinase activity. Canonical TGF-β signaling occurs when one of the three ligands binds to TGFBRII, which then recruits and phosphorylates TGFBRI. TGFBRII is a 567 amino acid single-pass type I membrane protein that contains one protein kinase domain. The process of PTH1R-TGFBRII endocytosis was blocked using a Ser/Thr kinase-dead mutation of TGFBRII. TGFBRII directly phosphorylates proteins other than itself or TGFBRI^[1][2].

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Mouse

HEK293

C-Fc

Q62312-2 (I24-D159)

21813  [NCBI]

IPPHVPKSVNSDVMASDNGGAVKLPQLCKFCDVRLSTCDNQKSCMSNCSITAICEKPHEVCVAVWRKNDKNITLETVCHDPKLTYHGFTLEDAASPKCVMKEKKRAGETFFMCACNMEECNDYIIFSEEYTTSSPD

55-65 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized after extensive dialysis against PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Vander Ark A, et al. TGF-β receptors: In and beyond TGF-β signaling. Cell Signal. 2018 Dec;52:112-120.  [Content Brief]

  [2]. Gao N, et al. Clinical Implications of TβRII Expression in Breast Cancer. PLoS One. 2015 Nov 9;10(11):e0141412.  [Content Brief]