1. Recombinant Proteins
  2. TGFBR2/TGF-beta RII Protein, Mouse (HEK293, Fc)

TGFBR2/TGF-beta RII Protein, Mouse (HEK293, Fc)

Cat. No.: HY-P7427
Handling Instructions

TGFBR2/TGF-beta RII Protein, Mouse (HEK293, Fc), a fragment of transforming growth factor-beta receptor type 2 (TβRII), consists of amino acid of Ile24-Asp159 with a 6His tag at the C-terminus.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $140 Ask For Quote & Lead Time
50 μg $490 Ask For Quote & Lead Time

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
TGFR-2; TGF-beta type II receptor; TGF-beta receptor type 2; TbetaR-II
Species

Mouse

Source

HEK 293

Accession

Q62312-2 (I24-D184)

Gene ID

21813

Molecular Weight

55-65 kDa

AA Sequence

IPPHVPKSVNSDVMASDNGGAVKLPQLCKFCDVRLSTCDNQKSCMSNCSITAICEKPHEVCVAVWRKNDKNITLETVCHDPKLTYHGFTLEDAASPKCVMKEKKRAGETFFMCACNMEECNDYIIFSEEYTTSSPD

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Transforming growth factor β (TGF-β) plays an important role in normal development and homeostasis. Dysregulation of TGF-β responsiveness and its downstream signaling pathways contribute to many diseases, including cancer initiation, progression, and metastasis. TGF-β ligands bind to three isoforms of the TGF-β receptor (TGFBR) with different affinities. TGFBRI and II are both serine/threonine and tyrosine kinases, but TGFBRIII does not have any kinase activity. Canonical TGF-β signaling occurs when one of the three ligands binds to TGFBRII, which then recruits and phosphorylates TGFBRI. TGFBRII is a 567 amino acid single-pass type I membrane protein that contains one protein kinase domain. The process of PTH1R-TGFBRII endocytosis was blocked using a Ser/Thr kinase-dead mutation of TGFBRII. TGFBRII directly phosphorylates proteins other than itself or TGFBRI[1][2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TGFBR2/TGF-beta RII Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P7427
Quantity:
MCE Japan Authorized Agent: