Thy1/CD90 Protein, Human (HEK293)

Customer Review

Based on 1 Customer Validation

Thy-1 membrane glycoprotein (THY1, CD90) is a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins. THY1 is involved in cell adhesion and cell communication particularly in cells of the immune and nervous systems. THY1 may function as a tumor suppressor in nasopharyngeal carcinoma and may play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain. Thy1/CD90 Protein, Human (HEK293) is the recombinant human-derived Thy1/CD90 protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Thy-1 membrane glycoprotein (THY1, CD90) is a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins. THY1 is involved in cell adhesion and cell communication particularly in cells of the immune and nervous systems. THY1 may function as a tumor suppressor in nasopharyngeal carcinoma and may play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain. Thy1/CD90 Protein, Human (HEK293) is the recombinant human-derived Thy1/CD90 protein, expressed by HEK293 , with tag free.

Background

Thy-1 membrane glycoprotein (THY1, CD90) is a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins. THY1 is involved in cell adhesion and cell communication in numerous cell types, but particularly in cells of the immune and nervous systems. THY1 is widely used as a marker for hematopoietic stem cells. THY1 may function as a tumor suppressor in nasopharyngeal carcinoma and may play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain, facilitating communication and connections between cells, shaping neural network architecture and functionality[1][2].

Verified Bioactivity

Human CD90 protein immobilized on CM5 Chip can bind Galectin-1 (HY-P70273) with an affinity constant of 1.91 μM as determined in SPR assay.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Thy1 (Q20-C130)
      Accession # NP_006279.2
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    THY1; CDNA, FLJ94676, Homo Sapiens Thy-1 Co-Transcribed (LOC94105), MRNA; Thy-1 Cell Surface Antigen; Thy-1 Membrane Glycoprotein Variant 1; Thy-1 Membrane Glycoprotein; Thy-1 Co-Transcribed Protein; Thy-1 Antigen; Thy-1 T-Cell Antigen; CD90; CD90 Antigen

  • AA Sequence

    QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC

  • Predicted Molecular Mass

    13.2 kDa

  • Molecular Weight

    Approximately 23-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00