1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins Stem Cell CD Proteins Endothelial cell CD Proteins
  4. Thy-1/CD90
  5. Thy1/CD90 Protein, Human (HEK293)

Thy1/CD90 Protein, Human (HEK293)

Cat. No.: HY-P74518
COA Handling Instructions

Thy-1 membrane glycoprotein (THY1, CD90) is a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins. THY1 is involved in cell adhesion and cell communication particularly in cells of the immune and nervous systems. THY1 may function as a tumor suppressor in nasopharyngeal carcinoma and may play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain. Thy1/CD90 Protein, Human (HEK293) is the recombinant human-derived Thy1/CD90 protein, expressed by HEK293 , with tag free. The total length of Thy1/CD90 Protein, Human (HEK293) is 111 a.a., with molecular weight of ~23-30 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $42 In-stock
10 μg $71 In-stock
50 μg $200 In-stock
100 μg $340 In-stock
500 μg $952 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Thy-1 membrane glycoprotein (THY1, CD90) is a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins. THY1 is involved in cell adhesion and cell communication particularly in cells of the immune and nervous systems. THY1 may function as a tumor suppressor in nasopharyngeal carcinoma and may play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain. Thy1/CD90 Protein, Human (HEK293) is the recombinant human-derived Thy1/CD90 protein, expressed by HEK293 , with tag free. The total length of Thy1/CD90 Protein, Human (HEK293) is 111 a.a., with molecular weight of ~23-30 kDa.

Background

Thy-1 membrane glycoprotein (THY1, CD90) is a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins. THY1 is involved in cell adhesion and cell communication in numerous cell types, but particularly in cells of the immune and nervous systems. THY1 is widely used as a marker for hematopoietic stem cells. THY1 may function as a tumor suppressor in nasopharyngeal carcinoma and may play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain, facilitating communication and connections between cells, shaping neural network architecture and functionality[1][2].

Species

Human

Source

HEK293

Tag

Tag Free

Accession

P04216/NP_006279.2(Q20-C130)

Gene ID
Molecular Construction
N-term
Thy1 (Q20-C130)
Accession # NP_006279.2
C-term
Synonyms
Thy-1 membrane glycoprotein; CDw90; Thy-1 antigen; CD90
AA Sequence

QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC

Molecular Weight

Approximately 23-30 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Thy1/CD90 Protein, Human (HEK293)
Cat. No.:
HY-P74518
Quantity:
MCE Japan Authorized Agent: