Thy1/CD90 Protein, Human (HEK293)
Based on 1 Customer Validation
Thy-1 membrane glycoprotein (THY1, CD90) is a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins. THY1 is involved in cell adhesion and cell communication particularly in cells of the immune and nervous systems. THY1 may function as a tumor suppressor in nasopharyngeal carcinoma and may play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain. Thy1/CD90 Protein, Human (HEK293) is the recombinant human-derived Thy1/CD90 protein, expressed by HEK293 , with tag free.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Thy-1 membrane glycoprotein (THY1, CD90) is a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins. THY1 is involved in cell adhesion and cell communication particularly in cells of the immune and nervous systems. THY1 may function as a tumor suppressor in nasopharyngeal carcinoma and may play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain. Thy1/CD90 Protein, Human (HEK293) is the recombinant human-derived Thy1/CD90 protein, expressed by HEK293 , with tag free.
Thy-1 membrane glycoprotein (THY1, CD90) is a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins. THY1 is involved in cell adhesion and cell communication in numerous cell types, but particularly in cells of the immune and nervous systems. THY1 is widely used as a marker for hematopoietic stem cells. THY1 may function as a tumor suppressor in nasopharyngeal carcinoma and may play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain, facilitating communication and connections between cells, shaping neural network architecture and functionality[1][2].
Human CD90 protein immobilized on CM5 Chip can bind Galectin-1 (HY-P70273) with an affinity constant of 1.91 μM as determined in SPR assay.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
P04216/NP_006279.2(Q20-C130)
-
Molecular Construction
-
N-term
-
Thy1 （Q20-C130）
Accession # NP_006279.2 -
C-term
-
-
Protein Length
Full Length of Thy1
-
Synonyms
THY1; CDNA, FLJ94676, Homo Sapiens Thy-1 Co-Transcribed (LOC94105), MRNA; Thy-1 Cell Surface Antigen; Thy-1 Membrane Glycoprotein Variant 1; Thy-1 Membrane Glycoprotein; Thy-1 Co-Transcribed Protein; Thy-1 Antigen; Thy-1 T-Cell Antigen; CD90; CD90 Antigen
-
AA Sequence
QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC
-
Predicted Molecular Mass
13.2 kDa
-
Molecular Weight
Approximately 23-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
