Thy1/CD90 Protein, Human (HEK293, Fc)

The Thy1/CD90 protein is involved in cell-cell or cell-ligand interactions, particularly during key events such as synaptogenesis, which means it plays a role in facilitating communication and connections between cells. Its specific involvement highlights the potential importance of Thy1/CD90 in shaping neural network architecture and function. Thy1/CD90 Protein, Human (HEK293, Fc) is the recombinant human-derived Thy1/CD90 protein, expressed by HEK293 , with C-hFc labeled tag.

The Thy1/CD90 protein appears to be involved in cell-cell or cell-ligand interactions, particularly during significant events such as synaptogenesis in the brain. This suggests a potential role for Thy1/CD90 in facilitating communication and connections between cells, contributing to the intricate processes associated with the formation and organization of synapses. The specific engagement of Thy1/CD90 in these interactions underscores its potential significance in shaping the architecture and functionality of neural networks. Further exploration into the precise mechanisms through which Thy1/CD90 participates in cell-cell or cell-ligand interactions during various neurodevelopmental events could offer valuable insights into its role in brain function and connectivity.

Measured by its binding ability in a functional ELISA. Immobilized Human CD90/Thy-1 at 5 μg/mL (100 μL/well) on the plate can bind Human Galectin-1 (HY-P70273). The ED₅₀ for this effect is 8.601 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Human CD90/Thy-1 at 5 μg/mL (100 μL/well) on the plate can bind Human Galectin-1 (HY-P70273). The ED₅₀ for this effect is 8.601 μg/mL.

Human

HEK293

C-hFc

P04216 (Q20-C130)

7070  [NCBI]

Full Length of Thy1

QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.