Copy Link Print Information

Thy1/CD90 Protein, Human (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

The Thy1/CD90 protein is involved in cell-cell or cell-ligand interactions, particularly during key events such as synaptogenesis, which means it plays a role in facilitating communication and connections between cells. Its specific involvement highlights the potential importance of Thy1/CD90 in shaping neural network architecture and function. Thy1/CD90 Protein, Human (HEK293, Fc) is the recombinant human-derived Thy1/CD90 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for Thy1/CD90 Protein, Human (HEK293, Fc)
  • Thy1/CD90 Protein, Human (HEK293, Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The Thy1/CD90 protein is involved in cell-cell or cell-ligand interactions, particularly during key events such as synaptogenesis, which means it plays a role in facilitating communication and connections between cells. Its specific involvement highlights the potential importance of Thy1/CD90 in shaping neural network architecture and function. Thy1/CD90 Protein, Human (HEK293, Fc) is the recombinant human-derived Thy1/CD90 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The Thy1/CD90 protein appears to be involved in cell-cell or cell-ligand interactions, particularly during significant events such as synaptogenesis in the brain. This suggests a potential role for Thy1/CD90 in facilitating communication and connections between cells, contributing to the intricate processes associated with the formation and organization of synapses. The specific engagement of Thy1/CD90 in these interactions underscores its potential significance in shaping the architecture and functionality of neural networks. Further exploration into the precise mechanisms through which Thy1/CD90 participates in cell-cell or cell-ligand interactions during various neurodevelopmental events could offer valuable insights into its role in brain function and connectivity.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human CD90/Thy-1 at 5 μg/mL (100 μL/well) on the plate can bind Human Galectin-1 (HY-P70273). The ED50 for this effect is 8.601 μg/mL.

MCE Validation Data

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Human CD90/Thy-1 at 5 μg/mL (100 μL/well) on the plate can bind Human Galectin-1 (HY-P70273). The ED50 for this effect is 8.601 μg/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-hFc
  • Accession

    P04216 (Q20-C130)

  • Gene ID
    7070  [NCBI]
  • Molecular Construction
    • N-term
    • Thy1 (Q20-C130)
      Accession # P04216
    • hFc
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    THY1; CDNA, FLJ94676, Homo Sapiens Thy-1 Co-Transcribed (LOC94105), MRNA; Thy-1 Cell Surface Antigen; Thy-1 Membrane Glycoprotein Variant 1; Thy-1 Membrane Glycoprotein; Thy-1 Co-Transcribed Protein; Thy-1 Antigen; Thy-1 T-Cell Antigen; CD90; CD90 Antigen

  • AA Sequence

    QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC

  • Predicted Molecular Mass

    39.3 kDa

  • Molecular Weight

    Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized Human CD90/Thy-1 at 5 μg/mL (100 μL/well) on the plate can bind Human Galectin-1 (HY-P70273). The ED50 for this effect is 8.601 μg/mL.

  • Thy1/CD90 Protein, Human (HEK293, Fc) Product Image
    1/16
  • Experimental Validation Results for Thy1/CD90 Protein, Human (HEK293, Fc)
  • Thy1/CD90 Protein, Human (HEK293, Fc) Product Image