Thy1/CD90 Protein, Human (HEK293, His)
The Thy1/CD90 protein is involved in cell-cell or cell-ligand interactions, particularly during key events such as synaptogenesis, which means it plays a role in facilitating communication and connections between cells. Its specific involvement highlights the potential importance of Thy1/CD90 in shaping neural network architecture and function. Thy1/CD90 Protein, Human (HEK293, His) is the recombinant human-derived Thy1/CD90 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The Thy1/CD90 protein is involved in cell-cell or cell-ligand interactions, particularly during key events such as synaptogenesis, which means it plays a role in facilitating communication and connections between cells. Its specific involvement highlights the potential importance of Thy1/CD90 in shaping neural network architecture and function. Thy1/CD90 Protein, Human (HEK293, His) is the recombinant human-derived Thy1/CD90 protein, expressed by HEK293 , with C-His labeled tag.
Background
The Thy1/CD90 protein appears to be involved in cell-cell or cell-ligand interactions, particularly during significant events such as synaptogenesis in the brain. This suggests a potential role for Thy1/CD90 in facilitating communication and connections between cells, contributing to the intricate processes associated with the formation and organization of synapses. The specific engagement of Thy1/CD90 in these interactions underscores its potential significance in shaping the architecture and functionality of neural networks. Further exploration into the precise mechanisms through which Thy1/CD90 participates in cell-cell or cell-ligand interactions during various neurodevelopmental events could offer valuable insights into its role in brain function and connectivity.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P04216 (Q20-C130)
-
Molecular Construction
-
N-term
-
Thy1 (Q20-C130)
Accession # P04216 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
THY1; CDNA, FLJ94676, Homo Sapiens Thy-1 Co-Transcribed (LOC94105), MRNA; Thy-1 Cell Surface Antigen; Thy-1 Membrane Glycoprotein Variant 1; Thy-1 Membrane Glycoprotein; Thy-1 Co-Transcribed Protein; Thy-1 Antigen; Thy-1 T-Cell Antigen; CD90; CD90 Antigen
-
AA Sequence
QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC
-
Predicted Molecular Mass
14 kDa
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)