1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins Stem Cell CD Proteins Endothelial cell CD Proteins
  4. Thy-1/CD90
  5. Thy1/CD90 Protein, Human (HEK293, His)

The Thy1/CD90 protein is involved in cell-cell or cell-ligand interactions, particularly during key events such as synaptogenesis, which means it plays a role in facilitating communication and connections between cells. Its specific involvement highlights the potential importance of Thy1/CD90 in shaping neural network architecture and function. Thy1/CD90 Protein, Human (HEK293, His) is the recombinant human-derived Thy1/CD90 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Thy1/CD90 protein is involved in cell-cell or cell-ligand interactions, particularly during key events such as synaptogenesis, which means it plays a role in facilitating communication and connections between cells. Its specific involvement highlights the potential importance of Thy1/CD90 in shaping neural network architecture and function. Thy1/CD90 Protein, Human (HEK293, His) is the recombinant human-derived Thy1/CD90 protein, expressed by HEK293 , with C-His labeled tag.

Background

The Thy1/CD90 protein appears to be involved in cell-cell or cell-ligand interactions, particularly during significant events such as synaptogenesis in the brain. This suggests a potential role for Thy1/CD90 in facilitating communication and connections between cells, contributing to the intricate processes associated with the formation and organization of synapses. The specific engagement of Thy1/CD90 in these interactions underscores its potential significance in shaping the architecture and functionality of neural networks. Further exploration into the precise mechanisms through which Thy1/CD90 participates in cell-cell or cell-ligand interactions during various neurodevelopmental events could offer valuable insights into its role in brain function and connectivity.

Species

Human

Source

HEK293

Tag

C-His

Accession

P04216 (Q20-C130)

Gene ID
Molecular Construction
N-term
Thy1 (Q20-C130)
Accession # P04216
His
C-term
Protein Length

Full Length of Thy1

Synonyms
Thy-1 membrane glycoprotein; CDw90; Thy-1 antigen; CD90
AA Sequence

QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC

Predicted Molecular Mass
14 kDa
Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Thy1/CD90 Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Thy1/CD90 Protein, Human (HEK293, His)
Cat. No.:
HY-P74516
Quantity:
MCE Japan Authorized Agent: