TIM-4/TIMD-4 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

T-cell immunoglobulin and mucin domain-containing protein 4 (TIMD4, TIM4) is a membrane protein in TIM family and is a phosphatidylserine receptor that plays different role in immune response including phagocytosis of apoptotic cells and T-cell regulation. TIMD4 controls T-cell activation in a bimodal fashion and promots the engulfment against apoptotic cells or exogenous particles. TIM-4/TIMD-4 Protein, Human (HEK293, His) is the recombinant human-derived TIM-4/TIMD-4 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

T-cell immunoglobulin and mucin domain-containing protein 4 (TIMD4, TIM4) is a membrane protein in TIM family and is a phosphatidylserine receptor that plays different role in immune response including phagocytosis of apoptotic cells and T-cell regulation. TIMD4 controls T-cell activation in a bimodal fashion and promots the engulfment against apoptotic cells or exogenous particles. TIM-4/TIMD-4 Protein, Human (HEK293, His) is the recombinant human-derived TIM-4/TIMD-4 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

T-cell immunoglobulin and mucin domain-containing protein 4 (TIMD4, TIM4) is a membrane protein in TIM family and is a phosphatidylserine receptor that plays different role in immune response including phagocytosis of apoptotic cells and T-cell regulation. TIMD4 controls T-cell activation in a bimodal fashion, decreasing the activation of naive T-cells by inducing cell cycle arrest, while increasing proliferation of activated T-cells by activating AKT1 and ERK1/2 phosphorylations and subsequent signaling pathways.
TIMD4 also plays a role in efferocytosis which is the process by which apoptotic cells are removed by phagocytic cells, promoting the engulfment of apoptotic cells or exogenous particles by securing them to phagocytes through direct binding to phosphatidylserine present on apoptotic cells, while other engulfment receptors such as MERTK efficiently recognize apoptotic cells and mediate their ingestion.
TIMD4 also promotes autophagy process by suppressing NLRP3 inflammasome activity via activation of LKB1/PRKAA1 pathway in a phosphatidylserine-dependent mechanism[1][2][3][4].

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • TIM-4 (E25-L315)
      Accession # AAH08988.1
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    TIMD4; T-Cell Membrane Protein 4; T Cell Immunoglobulin And Mucin Domain Containing 4; TIMD-4; TIM4; TIM-4; T-Cell Immunoglobulin And Mucin Domain-Containing Protein 4; T-Cell Immunoglobulin And Mucin Domain Containing 4; T-Cell Immunoglobulin Mucin Recep

  • AA Sequence

    ETVVTEVLGHRVTLPCLYSSWSHNSNSMCWGKDQCPYSGCKEALIRTDGMRVTSRKSAKYRLQGTIPRGDVSLTILNPSESDSGVYCCRIEVPGWFNDVKINVRLNLQRASTTTHRTATTTTRRTTTTSPTTTRQMTTTPAALPTTVVTTPDLTTGTPLQMTTIAVFTTANTCLSLTPSTLPEEATGLLTPEPSKEGPILTAESETVLPSDSWSSAESTSADTVLLTSKESKVWDLPSTSHVSMWKTSDSVSSPQPGASDTAVPEQNKTTKTGQMDGIPMSMKNEMPISQL

  • Predicted Molecular Mass

    32.3 kDa

  • Molecular Weight

    Approximately 60-90 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00