TIM-4/TIMD-4 Protein, Human (HEK293, His)
Based on 1 Customer Validation
T-cell immunoglobulin and mucin domain-containing protein 4 (TIMD4, TIM4) is a membrane protein in TIM family and is a phosphatidylserine receptor that plays different role in immune response including phagocytosis of apoptotic cells and T-cell regulation. TIMD4 controls T-cell activation in a bimodal fashion and promots the engulfment against apoptotic cells or exogenous particles. TIM-4/TIMD-4 Protein, Human (HEK293, His) is the recombinant human-derived TIM-4/TIMD-4 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
T-cell immunoglobulin and mucin domain-containing protein 4 (TIMD4, TIM4) is a membrane protein in TIM family and is a phosphatidylserine receptor that plays different role in immune response including phagocytosis of apoptotic cells and T-cell regulation. TIMD4 controls T-cell activation in a bimodal fashion and promots the engulfment against apoptotic cells or exogenous particles. TIM-4/TIMD-4 Protein, Human (HEK293, His) is the recombinant human-derived TIM-4/TIMD-4 protein, expressed by HEK293 , with C-6*His labeled tag.
T-cell immunoglobulin and mucin domain-containing protein 4 (TIMD4, TIM4) is a membrane protein in TIM family and is a phosphatidylserine receptor that plays different role in immune response including phagocytosis of apoptotic cells and T-cell regulation. TIMD4 controls T-cell activation in a bimodal fashion, decreasing the activation of naive T-cells by inducing cell cycle arrest, while increasing proliferation of activated T-cells by activating AKT1 and ERK1/2 phosphorylations and subsequent signaling pathways.
TIMD4 also plays a role in efferocytosis which is the process by which apoptotic cells are removed by phagocytic cells, promoting the engulfment of apoptotic cells or exogenous particles by securing them to phagocytes through direct binding to phosphatidylserine present on apoptotic cells, while other engulfment receptors such as MERTK efficiently recognize apoptotic cells and mediate their ingestion.
TIMD4 also promotes autophagy process by suppressing NLRP3 inflammasome activity via activation of LKB1/PRKAA1 pathway in a phosphatidylserine-dependent mechanism[1][2][3][4].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
AAH08988.1 (E25-L315)
-
Molecular Construction
-
N-term
-
TIM-4 (E25-L315)
Accession # AAH08988.1 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
TIMD4; T-Cell Membrane Protein 4; T Cell Immunoglobulin And Mucin Domain Containing 4; TIMD-4; TIM4; TIM-4; T-Cell Immunoglobulin And Mucin Domain-Containing Protein 4; T-Cell Immunoglobulin And Mucin Domain Containing 4; T-Cell Immunoglobulin Mucin Recep
-
AA Sequence
ETVVTEVLGHRVTLPCLYSSWSHNSNSMCWGKDQCPYSGCKEALIRTDGMRVTSRKSAKYRLQGTIPRGDVSLTILNPSESDSGVYCCRIEVPGWFNDVKINVRLNLQRASTTTHRTATTTTRRTTTTSPTTTRQMTTTPAALPTTVVTTPDLTTGTPLQMTTIAVFTTANTCLSLTPSTLPEEATGLLTPEPSKEGPILTAESETVLPSDSWSSAESTSADTVLLTSKESKVWDLPSTSHVSMWKTSDSVSSPQPGASDTAVPEQNKTTKTGQMDGIPMSMKNEMPISQL
-
Predicted Molecular Mass
32.3 kDa
-
Molecular Weight
Approximately 60-90 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
