TIMP-1 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The TIMP-1 protein forms a one-to-one complex with the target metalloprotease, irreversibly inactivating it by binding to the catalytic zinc cofactor. It inhibits multiple MMPs, activates cell signaling through CD63 and ITGB1, and interacts with MMP1, MMP3, MMP10, and MMP13. TIMP-1 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The TIMP-1 protein forms a one-to-one complex with the target metalloprotease, irreversibly inactivating it by binding to the catalytic zinc cofactor. It inhibits multiple MMPs, activates cell signaling through CD63 and ITGB1, and interacts with MMP1, MMP3, MMP10, and MMP13. TIMP-1 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-1 protein, expressed by HEK293 , with C-His labeled tag.
Background
TIMP-1, a metalloproteinase inhibitor, operates through the formation of one-to-one complexes with target metalloproteinases, including collagenases, leading to their irreversible inactivation by binding to the catalytic zinc cofactor. Its inhibitory spectrum encompasses MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13, and MMP16, excluding MMP14. Beyond its role as an enzyme inhibitor, TIMP-1 functions as a growth factor, orchestrating cell differentiation, migration, and cell death while activating intricate cellular signaling cascades through interactions with CD63 and ITGB1. This multifaceted protein also plays a crucial role in integrin signaling and, notably, mediates erythropoiesis in vitro, exhibiting species-specific stimulation of human and murine erythroid progenitors, distinct from IL3. Moreover, TIMP-1 engages in protein-protein interactions with MMP1, MMP3, MMP10, and MMP13, demonstrating its regulatory influence on these metalloproteinases. It forms a complex with CD63 and ITGB1, further emphasizing its involvement in complex cellular signaling networks.
Verified Bioactivity
1.Measured in a cell proliferation assay using NIH-3T3 mouse fibroblast cells. The ED50 this effect is 19.88 ng/mL, corresponding to a specific activity is 5.03×104 units/mg.
2.Measured by its ability to inhibit human MMP-2（HY-P73296）cleavage of a fluorogenic peptide substrate Mca-PLGL-Dpa-AR-NH2（HY-131498）that in cubate at room temperature in kinetic mode for 5 minutes. The IC50 value is 0.1-5.0 nM.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P01033 (C24-A207)
-
Molecular Construction
-
N-term
-
TIMP-1 (C24-A207)
Accession # P01033 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
TIMP1; Collagenase Inhibitor; Prev. CLGI; EPA; Prev. TIMP; Tissue Inhibitor Of Metalloproteinase 1 (Erythroid Potentiating Activity, Collagenase Inhibitor); Tissue Inhibitor Of Metalloproteinases 1; Epididymis Secretory Sperm Binding Protein; Metalloprote
-
AA Sequence
CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA
-
Predicted Molecular Mass
21.8 kDa
-
Molecular Weight
Approximately 27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
3.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
