TIMP-1 Protein, Rat (HEK293)

Customer Review

Based on 1 Customer Validation

The IgG3 Fc protein is the constant region of an immunoglobulin heavy chain that acts as a receptor for a specific antigen. TIMP-1 Protein, Rat (HEK293) is the recombinant rat-derived TIMP-1 protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The IgG3 Fc protein is the constant region of an immunoglobulin heavy chain that acts as a receptor for a specific antigen. TIMP-1 Protein, Rat (HEK293) is the recombinant rat-derived TIMP-1 protein, expressed by HEK293 , with tag free.

Background

The constant region of immunoglobulin heavy chains, known as antibodies, represents membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, these membrane-bound immunoglobulins act as receptors that, upon binding a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulin-secreting plasma cells. Secreted immunoglobulins play a pivotal role in the effector phase of humoral immunity, leading to the elimination of bound antigens. The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain, resulting in each immunoglobulin having two antigen binding sites with remarkable affinity for a particular antigen. The variable domains undergo a V-(D)-J rearrangement and subsequent somatic hypermutations, enabling affinity maturation for a specific antigen after exposure and selection. Immunoglobulins are comprised of two identical heavy chains and two identical light chains, held together by disulfide linkages.

Verified Bioactivity

Measured by its ability to inhibit human MMP2 cleavage of a fluorogenic peptide substrate MCA-PLGLDPA-AR-NH2 and the IC50 value is approximately <4 nM.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • TIMP-1 (C24-A217)
      Accession # P30120/NP_446271.1
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    TIMP1; Collagenase Inhibitor; Prev. CLGI; EPA; Prev. TIMP; Tissue Inhibitor Of Metalloproteinase 1 (Erythroid Potentiating Activity, Collagenase Inhibitor); Tissue Inhibitor Of Metalloproteinases 1; Epididymis Secretory Sperm Binding Protein; Metalloprote

  • AA Sequence

    CSCAPTHPQTAFCNSDLVIRAKFMGSPEIIETTLYQRYEIKMTKMLKGFDAVGNATGFRFAYTPAMESLCGYVHKSQNRSEEFLIAGRLRNGNLHITACSFLVPWHNLSPAQQKAFVKTYSAGCGVCTVFPCSAIPCKLESDSHCLWTDQILMGSEKGYQSDHFACLPRNPDLCTWQYLGVSMTRSLPLAKAEA

  • Predicted Molecular Mass

    21.5 kDa

  • Molecular Weight

    Approximately 28 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 100 mM NaCl, pH 7.0, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00